(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFQ

AL009126.YBFQ        Location/Qualifiers
FT   CDS_pept        252514..253482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfQ"
FT                   /locus_tag="BSU_02330"
FT                   /old_locus_tag="BSU02330"
FT                   /product="putative enzyme with rhodanese domain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10939241, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12027"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="SubtiList:BG12745"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31457"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12027.1"
FT                   /translation="MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEG
FT                   INGTVSGTVEQTEKYMETMKADPRFADMVFKIDEAEGHAFKKIFVRHKKELVTLRLEDD
FT                   VDPNETTGQHLKPAEFYEKMQDPNTIVIDARNDYEYDLGHFRGAVRPDIEAFRELPEWI
FT                   EEHKDMLEGKKILTYCTGGVRCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQGKLWD
FT                   GQCYVFDERISVPVNRVEHVIVGKDYFTGEPCERYVNCANPSCNKKMICTPENEYKYMR
FT                   SCSHECRTNPRNLYVKEHNMTEEEVNARLAAIETEDHAAAE"
     atggaaaaac aatacagagt attactttac tataaatatg ttccgattga agatccagag        60
     gcgtttagag agcagcatct ggctttttgt aaggagcttg gtttgttagg ccgtatcctt       120
     gtttcttctg aaggaattaa cggtacggta tcaggtacgg ttgaacagac tgaaaaatat       180
     atggaaacaa tgaaagctga tcctcgcttt gcggacatgg tatttaaaat tgatgaagca       240
     gaaggccatg ccttcaaaaa aatcttcgtc cgccataaaa aagagcttgt aacgcttcgt       300
     cttgaagatg atgtcgatcc gaacgaaaca acaggccagc atttgaagcc tgcagaattt       360
     tatgagaaga tgcaggatcc aaacacaatt gtcatcgacg cgcgtaacga ttacgagtat       420
     gaccttggcc atttcagagg tgcggtccgt cctgacatcg aagccttccg tgaattacct       480
     gaatggattg aagagcacaa agatatgctt gaaggcaaaa agattttaac gtactgtaca       540
     ggcggcgtgc gctgtgaaaa gttctcagga tggctggtga agcaaggctt tgaagatgta       600
     gctcagcttg atggcggaat cgtgacatac ggaaaagatc cagaggtgca aggcaagctt       660
     tgggacggcc agtgctacgt atttgatgaa agaatcagcg tgcctgtcaa ccgtgtcgag       720
     catgtgattg tcggcaagga ctactttaca ggagaaccgt gtgagcgtta tgtgaactgc       780
     gcaaatccat cttgcaataa aaaaatgata tgcacaccgg aaaatgagta taaatatatg       840
     cgcagctgca gccacgaatg ccgcacgaac ccaagaaacc tgtatgtgaa agagcataat       900
     atgacagaag aagaagtaaa cgcaagactg gcagcgattg aaacagaaga tcacgctgct       960
     gctgaataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page