(data stored in ACNUC7421 zone)

EMBL: AL009126.YBGB

AL009126.YBGB        Location/Qualifiers
FT   CDS_pept        258532..258807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgB"
FT                   /locus_tag="BSU_02380"
FT                   /old_locus_tag="BSU02380"
FT                   /product="conserved protein of unknown function (B.
FT                   subtilis-specific)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12897008, 23667565"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12032"
FT                   /db_xref="GOA:O31460"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="SubtiList:BG12748"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31460"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12032.1"
FT                   /translation="MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLT
FT                   VNKLAGTVMLPVLMVVFAWARKINWQFVFAVYILLICHIVVLCLAL"
     atgtttttat ttacgaatgg aaaagtgctg tggggagcag tgattgctgc attcatcctt        60
     tcaattgtat tttacccttt tctgccgacg cagatgccga ttcattatga tgttgcgaac       120
     agtccggatc tgacggttaa caagctggcg gggactgtga tgctgcctgt tttgatggtg       180
     gtgtttgcat gggcgcggaa gatcaattgg caatttgtat tcgcagtgta tattttgctg       240
     atttgccaca ttgtcgtcct ttgtttagcg ctctaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page