(data stored in SCRATCH zone)

EMBL: AL009126.YBGG

AL009126.YBGG        Location/Qualifiers
FT   CDS_pept        complement(261656..262603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /locus_tag="BSU_02410"
FT                   /old_locus_tag="BSU02410"
FT                   /product="homocysteine methylase using (R,S)AdoMet"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.10"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11267663, 15995196, 17264075;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12035"
FT                   /db_xref="GOA:O31463"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="SubtiList:BG12751"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31463"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12035.1"
FT                   /translation="MNPIQHILDTYPLIVLDGAMATELERKGCNLNDSLWSAKILMEEP
FT                   ELIKQVHTDYFAAGADCAITASYQSTFEGFAARGLSEAEARRLIELSVSIAAEARDEFW
FT                   SLEENRLNRPKPIIAASIGPYGAYLADGSEYRGNYAISEDELIEFHRPRMKALIEAGAD
FT                   VLACETIPCLTEAKAIVRLLKEFPETYAWISFSAKDGLHISDGTPAADCASWLDEHRQI
FT                   AALGINCTPLQHIPSLIEELKKNTSKPIIVYPNSGEQYDPETKTWNGAACAESYGASAR
FT                   TWHEKGARLIGGCCRTKPENIQEIAAWARSLKTT"
     atgaatccta tccaacacat attagataca tacccgctta ttgtgctaga cggcgccatg        60
     gcgaccgagc ttgaacgcaa gggctgtaat ttgaatgaca gtctgtggtc ggcaaaaatc       120
     ctgatggaag agccggagct gattaaacaa gttcatactg attattttgc ggcaggcgcc       180
     gattgtgcaa tcaccgccag ctatcagtct acatttgaag gctttgccgc acgcgggctg       240
     agcgaagcgg aagcacgccg gctcatcgag ttgtccgtca gcatcgcagc tgaagcacgt       300
     gatgaatttt ggtcgcttga agagaaccgt ttgaatcggc caaaaccgat cattgcggct       360
     tctataggcc cttatggcgc ttatcttgca gacgggtctg agtatcgcgg caactacgca       420
     atatcagaag atgaactgat tgaatttcat cgcccccgga tgaaggcgct gattgaagcc       480
     ggagctgatg tattggcatg cgaaacgatt ccgtgtctga ctgaagccaa agcgattgtt       540
     cggctgttga aggaatttcc tgaaacgtat gcatggatca gcttcagtgc taaagacggc       600
     ttgcatatca gtgacggaac acctgcagct gactgcgcat cgtggcttga tgaacaccgc       660
     caaattgcag cactcggcat caactgcacg ccgcttcagc atatcccttc cttgatagag       720
     gagttaaaaa agaacacgtc aaaaccgatc attgtctacc cgaattcagg tgagcaatat       780
     gatccggaaa caaaaacgtg gaacggcgca gcatgcgcag aatcttacgg ggcgagcgcc       840
     cgcacctggc atgaaaaagg agcgaggctg attggcggct gctgccggac aaaacccgaa       900
     aatattcaag aaattgcggc ttgggcccgc tctttaaaaa caacttga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page