(data stored in ACNUC7421 zone)

EMBL: AL009126.YBXG

AL009126.YBXG        Location/Qualifiers
FT   CDS_pept        226566..227954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BSU_02060"
FT                   /old_locus_tag="BSU02060"
FT                   /product="putative amino acid permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12000"
FT                   /db_xref="GOA:P54425"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG11505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12000.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMS
FT                   EIIAVGSYTKYWFPDLPAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMI
FT                   IAGIGIIFFGFGNGGDAIGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRNAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAA
FT                   AGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIG
FT                   LAVGVVLNYIAPPKIFVYVYSASVLPGMIPWFIILISHIGFRKAKGAALDKHPFKMPFA
FT                   PFTNYLTIAFLLMVLVGMWFNDDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSE
FT                   QAAE"
     gtggcaaata aagaattaaa gaggggcctg ggcgcgcgcc atattcagat gatcgccttg        60
     ggcggtacaa tcggtgttgg cttgtttatg ggttctgcca gcacgatttc atggactggc       120
     ccatctgtcc ttctggctta tgcaatatgc ggaattttta tcttttttat tatgcgtgcg       180
     atgggtgaaa tgctgtatgt cgagccgagc acaggttctt ttgcgacgtt cggccatcaa       240
     tatattcatc cgatggcagg ttatataaca gcatggagca actggttcca gtggattatc       300
     gtcggcatgt cagaaattat cgctgtcggt tcttatacga agtattggtt cccggatttg       360
     cctgcttgga tacctggtat cgtggcaatg gtgattcttg gtgcggcgaa tttaatttct       420
     gttaagtcgt ttggggaatt tgagttttgg tttgcgatga ttaaaatcgt gacgattatc       480
     ttgatgatta ttgcgggaat cggaattatt ttcttcggtt ttggcaatgg cggagatgcg       540
     atcggtttgt cgaacctgtg gtctcacggg ggcttctttg caggaggttt ctcaggtttc       600
     ttctttgcac tgtctcttgt cattgcagcc tatcaaggag ttgagctgat cgggattaca       660
     gcgggtgaag cgaaggaccc gcaaaacacg ctaagaaatg cgattcaaag tattatctgg       720
     cgtattttga ttttctacat tggcgctatt tttgtgatcg tgacggtgta tccttgggat       780
     gagctcaact cactcggaag tccgtttgtg tctacgttct cgaaaattgg aattacggca       840
     gcggccggca ttattaactt tgtcgtgatt actgcggcaa tgtccggctg taacagcggt       900
     attttcagcg cgggccgcat gctgtataca ctgggtgtca atggacaagc accgaaattc       960
     tttaagaaga tttcacgcaa tggtgtgccg ctgtatggca caattgcggt gctgatcggt      1020
     ttggctgtcg gcgttgtact gaactatatc gcgccgccga agatctttgt ctatgtatac      1080
     agcgcaagcg tgctcccagg gatgattcct tggtttatca ttttgatcag ccatatcgga      1140
     ttcagaaaag cgaagggtgc tgcattagat aaacatccat tcaaaatgcc gtttgctcct      1200
     tttacaaact atttgacgat tgctttcttg ctgatggttc tggttggcat gtggtttaac      1260
     gatgatactc gtatctccct gattgtaggc gtgattttct tagcgcttgt ggtcattagt      1320
     tattatgtgt ttgggattgg caaacgcacg caggccaatt tgacaaaaag cgaacaagca      1380
     gctgaataa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page