(data stored in ACNUC7421 zone)

EMBL: AL009126.YBXI

AL009126.YBXI        Location/Qualifiers
FT   CDS_pept        complement(228549..229352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxI"
FT                   /locus_tag="BSU_02090"
FT                   /old_locus_tag="BSU02090"
FT                   /product="exported beta-lactamase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.2.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14742199; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12003"
FT                   /db_xref="GOA:P54427"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:5E2F"
FT                   /db_xref="SubtiList:BG11507"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14742199"
FT                   /protein_id="CAB12003.1"
FT                   /translation="MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKD
FT                   TDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGV
FT                   KREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFW
FT                   LQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDM
FT                   GLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS"
     atgaaaaaat ggatatatgt tgtgcttgtg ctgagtattg cagggatcgg cggcttctcc        60
     gtccacgcag catcatctgc tcatgaaaaa cacttgaatg tcagcaaaat gaatgtcgat       120
     gatgaattca aggatacgga tggaaccttc attcttcacg atttacaaaa ggatcagaca       180
     tttgtctata acagaaaacg ggcaaatcaa agacaaactc cgcaatccac ctttaaagtc       240
     gtgaacgctt taatcggttt gcaggtcaaa gctgtaagag atgaatacga tgttaaacga       300
     tgggacgggg tcaagcgtga attcgaatca tggaaccgcg accatacgct tggctcggcc       360
     atgcgcgaat ccgcaatctg gtattatcag gcattagcga gagatatcgg cgaggaaaga       420
     atgaaaacat ggcttcatac tctatcttac ggcaacgagg atatcagcgg gggaatcgac       480
     cagttttggc tgcaaagctc gctcacaata tctccgctgg aacaagaaac ttttttggag       540
     aaactggcta aagaggagct tccatttgac aagccggtga tgaaaatcgt caagcgcatg       600
     atgattcaag aggaaggcga tcattacacg ctctacggga aaaccggaac ccgcctgact       660
     gatatgggat taggatggtt tgtcggattc atcaaaacag agcatggctc ttatgtcttt       720
     gtcaccaatg tcgatgattc cggcacaaaa gccaaaaaca tcaccgtgga tatcctgaaa       780
     aagtatggcc tgattacatc ctaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page