(data stored in SCRATCH zone)

EMBL: AL009126.YBYB

AL009126.YBYB        Location/Qualifiers
FT   CDS_pept        complement(230819..231079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybyB"
FT                   /locus_tag="BSU_02110"
FT                   /old_locus_tag="BSU02110"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12005"
FT                   /db_xref="SubtiList:BG12754"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31441"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12005.1"
FT                   /translation="MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQ
FT                   PDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQYYDEKKK"
     atgaaacaaa agctgttact ttcaggtctc gctgtttcaa ctgtcggcat cacttcttat        60
     ctattaaaag acccgtcaaa tcgccaaaag gcaagagaat tcattcacag catgaagatg       120
     aaaataacaa aacagccaga catggaaacg ttcccagttg ataaagccgg ccacccggac       180
     ccgcaagata tcgaggacaa caaaatggta tcagaaggct ccatgtatcc cgtccaatac       240
     tacgatgaaa aaaagaagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page