(data stored in ACNUC7421 zone)

EMBL: AL009126.YBZG

AL009126.YBZG        Location/Qualifiers
FT   CDS_pept        147312..147536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzG"
FT                   /locus_tag="BSU_01389"
FT                   /old_locus_tag="BSU01389"
FT                   /product="putative ribosome binding protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17157877; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01389"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52539"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3S8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52539.1"
FT                   /translation="MIGQKAWVNIGKTEFILLLVVGILTIINVLTADGEKRTFHSPKKK
FT                   NINHLTLYDCVSPEVQNSINETGRVTNFF"
     ttgatagggc agaaagcttg ggtgaacatt ggcaagaccg aattcatctt gcttcttgtc        60
     gttggaattt taaccatcat caatgtacta acagcagacg gagaaaagcg tacatttcat       120
     tctcctaaga aaaagaatat caatcattta accctttatg attgcgtatc tccggaagtt       180
     cagaacagta taaacgaaac agggcgtgtg acaaacttct tttga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page