(data stored in SCRATCH zone)

EMBL: AL009126.YBZI

AL009126.YBZI        Location/Qualifiers
FT   CDS_pept        222971..223234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzI"
FT                   /locus_tag="BSU_02019"
FT                   /old_locus_tag="BSU02019"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02019"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52542"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52542.1"
FT                   /translation="MNIICLKKSSKRLSTSQAVLVTDIADTGITAAAGADIIAATAAVR
FT                   AKEDTTTVMAAVIVTNAGATAAVNPKKVLVPLLGQGFFYVTD"
     gtgaacatca tatgtttaaa aaaatcatca aaacgattaa gtacctctca agcagttcta        60
     gtgaccgata tcgcagacac cggcattaca gcagcagccg gcgcagacat tatcgcagct       120
     acagcagcag ttcgggcaaa agaagacact acgaccgtta tggcggcagt catcgttaca       180
     aacgccggag ctacagcagc agttaatcca aaaaaagttc ttgttccgct tttgggacaa       240
     gggttttttt atgtgaccga ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page