(data stored in SCRATCH zone)

EMBL: AL009126.YCBJ

AL009126.YCBJ        Location/Qualifiers
FT   CDS_pept        275838..276758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="BSU_02520"
FT                   /old_locus_tag="BSU02520"
FT                   /product="putative phosphotransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12044674; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12046"
FT                   /db_xref="GOA:P42242"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="SubtiList:BG11165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42242"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12046.1"
FT                   /translation="MTNLNEKQLITEIVGLARSQGLTVHSENAQLNETGMDFQVVFAKD
FT                   DTGMPWVLRKPRRSDVVERASAEGITLAFLRANLTADVPDWRIHTPELIAYPMLKGTPA
FT                   AGIDLEQKQYVWNMDHQPPSDDFVRTLADILAELHGTDQISAGQSGIEVIRPEDFRQMT
FT                   ADSMVDVKNKLGVSTTLWERWQKWVDDDAYWPGFSSLIHGDLHPPHILIDQNGRVTGLL
FT                   DWTEAKVADPAKDFVLYQTIFGEKETARLLEYYDQAGGRIWAKMQEHISEMQAAYPVEI
FT                   AKLALQTQQEEHINMALEALGVTSD"
     atgacaaacc ttaacgaaaa acagcttatc actgagattg tcgggcttgc acgcagccaa        60
     ggtttgacgg ttcattctga gaacgcgcaa ttgaatgaaa ccggaatgga ctttcaagtt       120
     gtatttgcca aggacgacac aggtatgcca tgggtgctgc gaaaaccgcg gcgaagtgat       180
     gttgtggaaa gagcatctgc agaaggcata acgcttgcct ttctccgcgc gaatctgact       240
     gctgatgtgc cggattggag aattcataca ccggaattga tcgcttaccc catgttaaaa       300
     ggaacgccgg ctgctggaat tgacttggaa caaaagcaat atgtatggaa tatggatcat       360
     cagccgccgt cagacgactt tgtccgcaca cttgccgaca tactggctga attacatggc       420
     acggatcaaa tatctgctgg gcaatccgga atagaagtga taaggccaga agatttcagg       480
     caaatgacag cagactctat ggttgatgtg aagaataagc ttggcgtatc tacgacgctt       540
     tgggaaagat ggcaaaagtg ggtagatgat gatgcatact ggccgggttt ctcttctttg       600
     atacacggcg atctccaccc gccgcatatc cttatcgatc aaaatggacg tgtcacagga       660
     cttctggatt ggacagaagc gaaggttgct gacccagcca aggattttgt tctttatcaa       720
     accattttcg gagaaaaaga aactgcccgt ttgcttgaat actatgatca agcaggcggc       780
     cgaatatggg caaaaatgca ggaacacatc tcagagatgc aggcggcgta tccggtggaa       840
     atcgccaagc tagctctgca aacacagcag gaggaacaca tcaatatggc gctggaagca       900
     cttggtgtaa catcggatta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page