(data stored in ACNUC7421 zone)

EMBL: AL009126.YCBM

AL009126.YCBM        Location/Qualifiers
FT   CDS_pept        279059..279994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbM"
FT                   /locus_tag="BSU_02560"
FT                   /old_locus_tag="BSU02560"
FT                   /product="two-component sensor histidine kinase [YcbL]"
FT                   /function="16.3: Control"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295; Product type rc:
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12050"
FT                   /db_xref="GOA:P42245"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG11168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42245"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295"
FT                   /protein_id="CAB12050.2"
FT                   /translation="MTVLWVAAVIALACLNVIQFIMKKKRDGNLAYTADQLSYMLSRDS
FT                   AGQILLPTDDHALKDLLVNINLIVENRQQISAQFAKTEQSMKRMLTNMSHDLKTPLTVI
FT                   LGYIEAIQSDPNMPDEERERLLGKLRQKTNELIQMINSFFDLAKLESEDKEIPITKVHM
FT                   NDICKRNILHYYDAVQSKGFQAAIDIPDTPVYAQANEEALDRILQNLLSNAIQYGAAGK
FT                   LIGLTLSYDERNIAITVWDRGKGISETDQQRVFERLYTLEESRNKAFQGSGLGLTITKR
FT                   LTEKMGGIISVQSKPYERTAFTITLKRMTY"
     atgacagtgc tatgggtggc cgctgtcatc gctctggcgt gtctgaatgt gattcaattc        60
     ataatgaaaa agaagcggga cgggaatctg gcttacacgg ctgaccagct tagctacatg       120
     ctcagccggg attcggcagg acaaattttg cttcctacag acgatcatgc gctcaaagac       180
     ttgcttgtta acatcaatct tatcgttgag aatcgtcagc agatcagcgc ccaatttgcc       240
     aaaacagagc aatccatgaa gcggatgctg accaatatgt cgcacgacct gaaaacgccg       300
     ttaacggtca ttctcggtta tattgaagcc attcaaagtg acccgaacat gccggacgaa       360
     gagcgggaaa gattgctggg gaagctccgc cagaaaacaa atgaacttat tcagatgatc       420
     aattcctttt ttgatttagc gaaattagaa tctgaagata aagagatccc gatcaccaaa       480
     gtacatatga acgacatatg caaacgaaat atcctgcact attatgacgc tgttcagtca       540
     aaaggctttc aagcagccat cgatatcccc gatacgccgg tgtatgcgca ggcgaatgaa       600
     gaggctctgg acagaatcct gcaaaaccta ttgtccaatg cgattcaata tggcgcggcc       660
     ggcaagttaa tcgggctgac gctgtcttat gatgagagga acatcgccat caccgtatgg       720
     gatcgcggaa aagggattag tgaaaccgat cagcagcggg tgtttgagag gctgtacaca       780
     ctggaagaat ccagaaataa agcatttcaa ggaagcggct tgggtttaac catcacaaaa       840
     cggcttacag aaaaaatggg aggcatcata tccgtccaaa gcaagccgta cgaacggact       900
     gcatttacga tcacattgaa acgcatgaca tattaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page