(data stored in SCRATCH zone)

EMBL: AL009126.YCBN

AL009126.YCBN        Location/Qualifiers
FT   CDS_pept        280086..281009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbN"
FT                   /locus_tag="BSU_02570"
FT                   /old_locus_tag="BSU02570"
FT                   /product="putative ABC efflux transporter (ATP-binding
FT                   protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12486040; Product type
FT                   t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12051"
FT                   /db_xref="GOA:P42246"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11169"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42246"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12051.2"
FT                   /translation="MTYIVQTNGLTKTYQGKEVVSNVSMHIKKGEIYGFLGPNGAGKTT
FT                   IMKMLTSLVKPTSGEIIILGNKFTHTSYEVLGNIGSMIEYPIFYENLTAEENLDLHCEY
FT                   MGYHNKKAIQEVLDMVNLKQIDKKPVKTFSLGMKQRLGIARAILTKPDLLILDEPVNGL
FT                   DPLGIKKIRQLFQVLSKEYGMTLLISSHLLGEIEQIADTIGVIRDGRLLEEVSMEDVRG
FT                   QNTEYIELVTPNQTRACFVLEKELQLTNFKILNEKTIRIYEAEASQAAISKALILNDVD
FT                   IESMNKKYTSLEDYFIKLINGNSISA"
     ttgacttata tcgtacaaac aaacgggctg accaaaacat atcagggcaa agaggtcgta        60
     tccaatgtca gcatgcatat taaaaaaggt gaaatctatg gctttctcgg cccgaacggc       120
     gcggggaaaa caaccattat gaaaatgctg acgagccttg tcaaaccgac aagcggtgaa       180
     atcatcatcc ttgggaacaa gttcacccac acgtcatatg aggtgctggg gaacatcggc       240
     agcatgattg aatatccgat tttttatgaa aacctgacag ctgaagaaaa tttagatctg       300
     cattgtgaat atatgggata ccacaataaa aaagccatac aagaagtgct ggatatggtg       360
     aatttaaaac aaatcgacaa aaaacccgtc aaaacctttt ccctcgggat gaagcagcgc       420
     cttggaattg cgcgtgccat cctcacgaag ccggacctgc ttattctgga tgagccggtg       480
     aatggtcttg accctctcgg cattaaaaag atcaggcaat tgtttcaagt gctgagcaaa       540
     gagtacggga tgacgctgct gatctcaagc cacctgctgg gtgaaatcga acaaatcgcg       600
     gacacaatcg gcgtcattcg ggacggcagg ctgcttgaag aggtatcaat ggaggatgtc       660
     aggggccaga acactgaata catcgagctt gtcacgccga atcagacaag ggcctgcttt       720
     gtgctggaga aagagctgca attaaccaac tttaaaatat taaatgagaa aacgattcga       780
     atttacgagg ctgaagcctc tcaggctgcc atatccaaag cattgatttt aaatgatgta       840
     gacattgaat caatgaacaa aaagtatacg tcgctggagg attattttat caaattgatc       900
     aacggcaata gcatcagtgc gtaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page