(data stored in ACNUC7421 zone)

EMBL: AL009126.YCBP

AL009126.YCBP        Location/Qualifiers
FT   CDS_pept        complement(281769..282155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /locus_tag="BSU_02590"
FT                   /old_locus_tag="BSU02590"
FT                   /product="putative inner integral membrane protein"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   22582280; Product type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12053"
FT                   /db_xref="GOA:P42248"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="SubtiList:BG11171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42248"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12053.1"
FT                   /translation="MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISY
FT                   LLGDLYVLPKWNNMIATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGE
FT                   YCFHFYMMSKEIGKKHYLETRTDS"
     atgacacatg tgaaagcgct cgctattaaa ggtattatga cgattattgt gttgtatctg        60
     gtgcttggtc tgggctttgg tttcacgttt ggtgatacgc tgctaatgac gattgtgtta       120
     ggggttattt cttatttgct gggcgatctt tatgtattgc cgaaatggaa taatatgatt       180
     gcaactttgg ctgattttgg tttggccttt ctcgtgatct ggctgatggg catgccgctt       240
     tctatgggga tgactggcgg tgaagttgca ttggcggctt tattcggcgc gatcgtcatg       300
     gcaatcggtg aatattgctt ccatttctat atgatgagca aagagattgg caagaagcat       360
     tatcttgaaa caagaacaga ctcataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page