(data stored in ACNUC7421 zone)

EMBL: AL009126.YCBU

AL009126.YCBU        Location/Qualifiers
FT   CDS_pept        287499..288611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbU"
FT                   /locus_tag="BSU_02660"
FT                   /old_locus_tag="BSU02660"
FT                   /product="putative lyase (PLP-dependent)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12060"
FT                   /db_xref="GOA:P42253"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="SubtiList:BG11176"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42253"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12060.2"
FT                   /translation="MEHLPEQYRQLFPTLQTHTMLASCSQSALAEPVSRAIQDYYDSLL
FT                   YKGTNWKEAIEKTEFARNEFAKLIGAEPDEVAIVPSVSDALVSVASSLTAFGKKHVVYT
FT                   DMDFPAVPHVWQAHSDYTVSVIPSIDGVLPLEQYETHISDETVLTCVPHVHYRDGYVQD
FT                   IKAIAEISQRKGSLLFVDAYQSAGHIPIDVKEWGVDMLAAGTRKYLLGIPGVAFLYVRK
FT                   ELADALKPKASAWFGRESGFDGAYAKVARRFQTGTPAFISVYAAAAALSLLNHIGVSHI
FT                   RDHVKTICADAVQYAAEKGLQLAAAQGGIQPGMVAIRDERASETAGLLKKKKVICAPRE
FT                   NVIRLAPHFYNTKEEMRHAIDEIAAKTIHK"
     atggagcatt tgccggagca gtatcgccag ttattcccaa ccttgcagac gcatacgatg        60
     cttgccagct gttctcagag cgcattggca gagcctgtat caagggcgat ccaggattat       120
     tatgatagcc tgctgtataa agggacgaac tggaaagaag cgattgaaaa aacagagttt       180
     gcgagaaacg agtttgcaaa gctgatcggg gctgaaccgg atgaagtggc gattgtgccg       240
     tcagtttctg atgcactggt ttctgtagca tcgtccttaa ctgcatttgg aaagaagcac       300
     gttgtatata cagatatgga ttttccggcg gtgcctcatg tttggcaggc acactccgat       360
     tataccgtat ccgtcattcc atcaatagac ggcgtgctgc cgcttgaaca atatgaaacg       420
     catatttcgg atgaaacagt actgacgtgt gttcctcacg ttcattatcg tgacggctat       480
     gttcaggata taaaagcgat tgccgagatt tctcagagaa agggctcttt attgtttgta       540
     gatgcttatc aatcagccgg gcatattccc attgatgtga aggaatgggg cgtagatatg       600
     ctggcagcag gcacccggaa gtatttgctc ggcataccgg gtgtggcgtt tctttatgtg       660
     agaaaggagc tggctgacgc actgaagccg aaagcatcag cttggttcgg aagagagagc       720
     ggatttgatg gggcttatgc aaaagtcgcg cgccgttttc aaacgggcac cccagctttt       780
     atcagcgtat acgcagctgc agcggcttta tcgctgctga atcatattgg ggtttctcat       840
     atcagggatc atgtgaaaac gatctgtgcc gatgcagttc aatatgccgc tgaaaaaggc       900
     ctgcagctgg cggcggcaca aggtgggatt cagccgggca tggttgcgat ccgggatgag       960
     cgggcatcgg aaacggcggg gttgctgaag aagaaaaaag tgatttgcgc gccgcgggaa      1020
     aatgttatcc gtctcgctcc ccatttttat aatacgaagg aggaaatgcg gcacgcgatt      1080
     gatgaaatcg cggcgaaaac gatccacaag taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page