(data stored in SCRATCH zone)

EMBL: AL009126.YCCF

AL009126.YCCF        Location/Qualifiers
FT   CDS_pept        293499..294575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /locus_tag="BSU_02720"
FT                   /old_locus_tag="BSU02720"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12066"
FT                   /db_xref="GOA:O34478"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="SubtiList:BG12756"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34478"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12066.1"
FT                   /translation="MGKVKRNAPCPCGSGKKYKKCCGSKVVDFPAELAAKEAKQIQEDL
FT                   VEYAFTVHRESISGFINQHDFLSAMDRQTKDISVFNLGIWGIFFHPLAGEKTIFEEYLQ
FT                   KKGDSITRPKTREIVESWQSMTPALLLLKDLKEGIIHFEDVITAKQFEVEMDASNQDLP
FT                   PVGSLILGYPIHEAEKAEFFMQFTIFPVKRTEALISKVKKYADAAVKDGKTPEDFMKQE
FT                   FNNVLFALLAEKDEEPQAEKAEVSTVEWANDLEKETAAAIEEGMSGEEYPTELIPAVID
FT                   IWKTFCEKKSPVIRKPEAFAAAVEYYVNAISLNGASVSQAKLAKKYGVSASTISSRYKE
FT                   IESTLQDEADRFAQALSS"
     gtgggaaaag tgaaacgaaa tgccccttgc ccatgcggca gcggcaagaa atataaaaaa        60
     tgctgcggaa gtaaagttgt cgacttcccg gcggaactag cggcaaaaga agcgaaacaa       120
     attcaggaag acttagtgga gtatgccttc acagtacata gagaaagcat ttcaggcttt       180
     atcaaccagc atgattttct ttctgctatg gacagacaga cgaaagacat cagcgtattt       240
     aacttaggaa tctggggaat cttcttccac ccgcttgctg gtgagaagac aatcttcgaa       300
     gagtaccttc agaaaaaagg cgattcgatc actcgtccga aaacgcgtga gatcgtagaa       360
     tcatggcaga gcatgacgcc tgctttattg ctgctgaagg acctgaagga aggcatcatt       420
     cactttgaag atgtcattac ggcaaaacaa ttcgaagtgg aaatggacgc cagcaatcaa       480
     gaccttcctc cagtgggaag cctgattctt ggatacccaa tccacgaagc ggaaaaagca       540
     gaattcttca tgcagttcac gatcttcccg gtgaagagaa cagaagcgct gatcagcaag       600
     gtgaagaaat atgcggatgc cgctgtgaag gacggcaaaa cgccggagga cttcatgaag       660
     caggaattca acaacgttct gttcgcgttg ttagctgaga aagatgaaga gccacaagca       720
     gagaaagcgg aagtaagcac tgttgagtgg gcaaacgact tggagaaaga aaccgctgcg       780
     gctattgaag aaggcatgag cggggaagag tatccgactg aattgatccc agctgttatt       840
     gacatctgga aaacattctg cgagaaaaaa tcacctgtca tcagaaagcc ggaagctttt       900
     gcggcggcag ttgaatatta tgtaaacgca atttctctta acggcgcgtc cgtttcccag       960
     gctaaactgg cgaaaaaata cggcgttagc gcatcaacga tttccagccg ttacaaagaa      1020
     attgaaagca cgctgcaaga tgaagcagat cgttttgcac aagcgttatc ctcataa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page