(data stored in ACNUC7421 zone)

EMBL: AL009126.YCCK

AL009126.YCCK        Location/Qualifiers
FT   CDS_pept        298466..299398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /locus_tag="BSU_02770"
FT                   /old_locus_tag="BSU02770"
FT                   /product="putative ion channel associated aldo-keto
FT                   reductase"
FT                   /function="16.1: Circulate"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17322186, 24330391;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12071"
FT                   /db_xref="GOA:P46905"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="SubtiList:BG11340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46905"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12071.1"
FT                   /translation="MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTA
FT                   LDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREF
FT                   LRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQ
FT                   LQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTV
FT                   FDDFRKDKPQFQGETFIHNLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAK
FT                   RPEQLQDNLKTLNIELTEDEVNFISDIFK"
     atggatcaaa cacgtacact cggcaaaacg aagctgaagg tgaagcggat cggattcggc        60
     gcgaatgcgg tcggcgggca taatctattt ccaaatctaa atgatgaaac agggaaggat       120
     ttagtgcgca cggcattgga tggcggcgtc aattttatcg ataccgcctt tatatatgga       180
     ttggggcgat ctgaagaatt aatcggcgaa gtcgtacagg aacgcggcgt gcggaatgag       240
     ctcatcatcg ccaccaaagg agctcataaa gaagtggacg gcagcattga attagacaat       300
     agccgggagt ttcttcgcag cgaggtggag aagagcctga agcggctgaa aacagattac       360
     attgatttgt attatgttca ctttccggat ggaaaaacac ctctcgctga agtggcgggc       420
     actttgaaag agctgaagga tgaggggaaa atcaaagcga tcggcgcttc gaacctcgat       480
     tatcagcaat tgcaggattt taatgctgac ggctatttgg aggtcttcca ggccgaatat       540
     tctctcatac agcgtgatgc cgagaaagag cttcttccat actgtgaaaa acaaggcatc       600
     tcctttattc cttactttcc gcttgcgtcc ggactgctga caggaaaatt cacgcaagac       660
     acagtctttg atgatttcag aaaggataaa cctcaatttc agggtgaaac gtttatccac       720
     aatctcaaaa aagtagataa gctgaaagca gtagcggagg aaaaacaagc ggatacggca       780
     catgtcgcct tggcgtggct gttaacgaga ccggcgattg atgccattat tccaggagct       840
     aaacgaccgg agcaattaca ggataacctg aaaaccttga acattgaact gaccgaagat       900
     gaagtgaatt tcatcagcga cattttcaaa taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page