(data stored in SCRATCH zone)

EMBL: AL009126.YCDB

AL009126.YCDB        Location/Qualifiers
FT   CDS_pept        300830..302248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdB"
FT                   /locus_tag="BSU_02790"
FT                   /old_locus_tag="BSU02790"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12073"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="SubtiList:BG12758"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34621"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12073.1"
FT                   /translation="MKGAAFVKKEGLKQKALEIGRVPTHLKLEIEDYGGDDKRAHFCWA
FT                   DPQDENTGIIVELGPDGELESLSRDIEPESGERLSEEKLEDIMRQFVETHHPGALSAFV
FT                   REENDRAYGDKVRFSYVQMEAGLPLPMSGFMADVSLSGEIVYFRYYGEAGSIIKPKRVA
FT                   DVEEALAFIKKDVEFDLLFEVLHRSVYKNGDDQPHLVYEPEGRAITVPADLVQEEQAVD
FT                   DDDDYREPESFPLPLFEGIREKADPDSMIGIENGFVKEREADLGDGRIGIVWRNPDDPV
FT                   YQPADKSMDSWFKGRTHQVLKTIYNKETGKLEGVMSFMEKKGPLTVTLAECEKIALRFL
FT                   FALFPNADQYFRIRYDEKDEEENAVAGFTFEAHCHGVPLRFGQIRICVSRQTGYITVYM
FT                   GPDIDPNKLATIDPVPAISVEQAKSIFWQHFKVELGWEREYGDDEEHSYRLVYKPVYPH
FT                   FIDAHTGEPVFSIW"
     atgaaagggg ccgcctttgt gaagaaagag ggactgaaac aaaaagcact ggaaatcggc        60
     cgggtgccga cacacttaaa actggaaatt gaagattatg gcggtgatga taaaagagct       120
     catttttgtt gggcagatcc tcaggatgag aataccggca ttatcgtgga gcttggaccg       180
     gacggagagc tggaatccct ttcccgtgat attgagcctg aaagcggaga aaggctgtct       240
     gaggagaaac tagaggatat catgcgccaa tttgtcgaga ctcatcatcc gggggcactc       300
     tctgcctttg ttcgtgaaga aaatgaccgt gcatacggcg ataaagtgag attttcatat       360
     gttcaaatgg aggctgggct tcctctcccc atgagcggat ttatggctga tgtttcctta       420
     tcaggtgaga ttgtttactt ccgttattac ggcgaagcgg gcagcatcat caagccaaag       480
     cgggtcgcgg atgttgaaga ggcacttgcc tttatcaaga aggacgtgga gttcgacctt       540
     ttgtttgagg ttctccatcg ttctgtttac aaaaacggag atgatcagcc gcatttggtg       600
     tacgagcctg aaggtagggc gattaccgta cctgcggatt tggttcaaga agaacaagca       660
     gttgatgatg acgatgatta cagggagccg gagagctttc ctctcccttt attcgagggc       720
     atccgcgaaa aggccgatcc tgacagcatg attggtattg aaaatgggtt tgtcaaagag       780
     cgggaagcgg atttgggaga tgggagaatt ggaatcgttt ggcggaatcc ggatgaccct       840
     gtgtatcagc cggcggataa aagcatggac agctggttta agggacggac tcatcaagtg       900
     ctgaaaacca tctataacaa agaaaccgga aaactcgaag gcgtcatgtc atttatggag       960
     aaaaaagggc cgctgacagt aaccttggca gagtgtgaaa aaatcgcgct tcgctttcta      1020
     tttgctttat ttccgaatgc cgatcaatat tttaggatca gatacgacga aaaagatgaa      1080
     gaagaaaacg cagtcgctgg ttttacgttt gaagcgcatt gtcacggagt tccgctccga      1140
     tttgggcaga tcagaatttg tgtcagccgc cagacagggt atatcaccgt ttatatggga      1200
     ccggatattg acccaaataa gctggcaacc attgatcctg tgccggctat ttcagttgaa      1260
     caagccaagt ctatcttttg gcagcatttt aaagttgagc ttggctggga aagagagtac      1320
     ggggatgatg aagaacacag ctaccggctc gtctataagc cggtgtatcc gcattttatc      1380
     gatgcacata caggggagcc tgtcttcagc atatggtga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page