(data stored in SCRATCH zone)

EMBL: AL009126.YCDC

AL009126.YCDC        Location/Qualifiers
FT   CDS_pept        302435..303796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /locus_tag="BSU_02800"
FT                   /old_locus_tag="BSU02800"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12074"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="SubtiList:BG12759"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34772"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12074.1"
FT                   /translation="MVNKQLKKKAQEIGNVPTHYELEIEDYDQKQKKYGQAYFIWKDPK
FT                   DPEKHITVELRNDGALLTFSTTVHSETDKKLPDAELKLTALQFAAANHPGTFMNFHFQG
FT                   KEERGQHIRFVYTKMELGLPIPNSGFLIDMTRSGQIVHFLYYGEGHKAEVPTEFVAKEK
FT                   VVSHYLNTMSFELMYDVIDGEQEPRLVYEPILPGYSYPADVDEIVPDQHIADERIENTA
FT                   PLPPLQNKEEVDIFALLGFTSDMQKVSERDFGEQIGSTWRRGAAPERKDLSIGSYFETR
FT                   NKNTIKMKTDKRTGKLKAALSFMDWRNNLQCSTEECQEIALQFLYALYPRAAEFFRVNP
FT                   VRIDERGRVRNHFSVWYKGVPLRFGAARIIVNPETGLIDAFMAPDIEPEQLEAINHRPD
FT                   VSAEEAKEAFLAAFDVKLEWQPDFTAGSDQHCKLVYKPVYPSYIDAHIRKKKRL"
     ttggttaata aacagctgaa aaagaaggcg caggagatcg gaaatgtacc gacgcattat        60
     gagcttgaga tagaagatta cgaccaaaag caaaagaagt acgggcaggc atattttatc       120
     tggaaggacc ctaaagatcc ggaaaagcac attacagttg aacttagaaa tgacggcgcc       180
     ttgctcacct tttcaacaac tgtccactcc gagacagaca aaaaacttcc agatgccgag       240
     ctgaagctga cggctcttca gtttgccgct gccaatcatc ccggcacatt tatgaatttt       300
     cattttcaag gcaaggaaga aagggggcag cacatccggt ttgtctatac caaaatggag       360
     ctggggcttc cgattcccaa ttcaggcttt ttaattgata tgacacgaag cggtcagatt       420
     gtccactttc tatattacgg ggaagggcat aaagccgaag ttccgacgga atttgtagca       480
     aaagagaagg ttgtatccca ttacttaaac acaatgtctt ttgagctgat gtacgatgtc       540
     attgatggcg aacaggaacc aaggcttgta tatgaaccga ttctaccggg atacagctat       600
     cccgcagatg tagacgaaat tgtgcccgac cagcatatcg cagatgaaag aatagaaaac       660
     acggcgccac tgccgccgct tcagaacaag gaagaagttg atatatttgc cttgctgggt       720
     tttacctctg atatgcagaa agtcagtgaa agagactttg gagaacaaat tggaagcacg       780
     tggcgcaggg gcgctgcgcc ggagcgtaag gatttaagca taggaagcta ttttgaaacg       840
     agaaataaaa atacaatcaa aatgaagacg gataaaagaa ccggaaaatt aaaagcagcg       900
     ctttctttta tggactggcg gaacaacctc caatgctcca cggaagaatg ccaagagata       960
     gcgcttcaat ttttgtatgc cctctatccg agagcggctg agtttttcag ggtgaatccc      1020
     gtccgaattg atgaaagagg gagagtccgc aaccattttt ctgtctggta taaaggagtg      1080
     ccgctgcggt tcggcgctgc ccgcatcatt gtcaatccgg aaactgggtt gattgacgct      1140
     tttatggcgc ctgatattga acctgaacaa ttggaagcga taaatcacag gccggatgtt      1200
     tccgctgaag aagcgaaaga agcattttta gccgcttttg atgtgaaact ggaatggcag      1260
     cctgatttta cagcaggcag tgaccagcac tgcaaacttg tctataagcc ggtttaccct      1320
     tcctatattg atgcgcacat aaggaaaaag aaaaggctgt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page