(data stored in ACNUC7421 zone)

EMBL: AL009126.YCDF

AL009126.YCDF        Location/Qualifiers
FT   CDS_pept        305658..306434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="BSU_02830"
FT                   /old_locus_tag="BSU02830"
FT                   /product="putative oxidoreductase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166, 11948145,
FT                   15805528; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12077"
FT                   /db_xref="GOA:P80869"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG12761"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80869"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12077.1"
FT                   /translation="MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGA
FT                   DETLEIIKQNGGKAVSVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHE
FT                   MSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSK
FT                   GGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPE
FT                   EVAAAAAWLVSEEASYVTGATLFVDGGMTLYPSQLE"
     atgtacaaag atttaaccgg aaaaacagcg attgtgacag ggtcttcaaa aggaatcggg        60
     aaagccattg cggaacggtt cggaaaggag aaaatgaatg ttgttgtaaa ttaccacagc       120
     gacccgtctg gagcagatga aactctggaa atcattaagc agaacggagg gaaagccgtc       180
     tcagttgagg cggacgtgtc aaaagaagag gggattcagg cgctcttgga cacagcttta       240
     gagcatttcg gcacgctcga tgtgatggta aacaactccg gttttaacgg cgttgaggcg       300
     atgccgcatg agatgagtct tgaagattgg cagagagtga ttgatgtcaa tgttaccgga       360
     acctttctgg gagcgaaagc agcacttaac cacatgatga aaaacaatat caagggcaat       420
     gtgctgaata tctcaagtgt tcatcagcag attccgcgcc ctgtaaacgt tcagtattcc       480
     acatccaaag gcggcatcaa gatgatgacg gaaacgctgg cgctcaatta tgcggataag       540
     ggaatccgcg tcaatgcgat agcgcccggc accattgcca cagaatcaaa tgttgatacg       600
     aaaaaggaag agagcaggca aaaacaattg aaaaaaatcc cgatgaaagc cttcggaaag       660
     cctgaagaag tggcggcagc agcagcttgg ctcgtatctg aggaagcaag ctatgtgacc       720
     ggcgcaacac ttttcgtcga cggcggaatg acactttatc catctcagct tgaatag          777
//

If you have problems or comments...

PBIL Back to PBIL home page