(data stored in ACNUC7421 zone)

EMBL: AL009126.YCDG

AL009126.YCDG        Location/Qualifiers
FT   CDS_pept        306459..308144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdG"
FT                   /locus_tag="BSU_02840"
FT                   /old_locus_tag="BSU02840"
FT                   /product="putative oligo-carbohydrate hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.10"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11544224; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12078"
FT                   /db_xref="GOA:O34364"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="SubtiList:BG12762"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34364"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12078.1"
FT                   /translation="MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGA
FT                   DVIWICPIYPSPNVDYGYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHT
FT                   SVEHPWFKEAELDKNSKYRSYYYWRPGTKNGPPTDWLSNYGCPVWQYEEHTGEYYLHMN
FT                   AVKQADLNWENPEVRQAVYDMMKFWLDKGVDGLRIDQLHLISKKEYLPSYEDYINQQAE
FT                   PKPFQPNGERIHDYLKEITDEVFSHYDVMSVGEVGSVTPEEGLKYTGTDKHELNMIFHF
FT                   QHMELDQQPGKEHWDLKPLELSDLKSVLTKWQKKLEHQGWNTLFWCNHDQPRIVSRFGD
FT                   DGEYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNAPFTRIEDYKDIQTINMYHKRVFE
FT                   KGYDPNDVMRSILAKSRDHARTPMQWNSGKNAGFTDGTPWLKVNPNFTAINVEEAQGDP
FT                   DSVLNYYKKLISLRKQYADLMKGSFDLLLPDDPQLFVYMRENSKQQLLSVNNFSKEQAV
FT                   FQWPKNCGKAQASLLLSNYNNDDLDDEMVFRPYESRVYLLDKTN"
     atgaaaacag actggtggaa ggatgcagtg gtgtaccaaa tttacccgag aagctttcag        60
     gacagcaatg gagacggaat tggggacttg cgggggatta tttcccgtct tgactacata       120
     aaggagctcg gggcagatgt gatttggatt tgcccgatct atccttctcc gaatgttgat       180
     tacggctatg atgtgacaaa ccataaggcg attatggatt cttacggaac aatggacgat       240
     tttcacgagc tgctggacca ggtgcatcag cggggattaa agctggtgat ggactttgtg       300
     ttaaatcaca cctcggtcga gcatccgtgg tttaaagaag cggagctgga caaaaacagc       360
     aaataccgta gctattatta ttggcgtccc ggcacaaaga acggcccgcc gacggactgg       420
     ctctcaaact atggatgccc ggtctggcaa tacgaagagc acaccggaga atactatctc       480
     catatgaatg ccgtcaaaca agctgattta aactgggaaa atcccgaagt tcgccaggcg       540
     gtgtatgaca tgatgaaatt ttggctcgat aaaggggtcg acggtttgcg aattgatcag       600
     ctccatctca tttctaagaa agaatatctt ccttcgtatg aggactatat caatcagcag       660
     gcagagccga agccctttca gccaaatggc gaacgaatcc atgactattt aaaagaaatc       720
     acagatgaag tgttttctca ttatgatgtc atgtctgtcg gagaggtcgg cagtgtcaca       780
     ccggaagaag gcctgaaata tacgggaaca gataagcatg agctgaatat gatttttcac       840
     tttcagcata tggagcttga tcagcagccc ggaaaagaac attgggattt gaagcccctt       900
     gagctttctg atttaaaatc ggttttgaca aaatggcaaa agaagcttga acatcaaggc       960
     tggaatacat tgttttggtg caaccacgac cagccccgga ttgtgtccag attcggagac      1020
     gatggggaat accgcaaagc atcagcgaaa atgctggcag ccgtaattta ttttatgaag      1080
     ggcacgccgt atatttatca gggagaagaa atcgggatga caaacgcgcc gttcacccgg      1140
     attgaagact acaaagatat ccaaacgatc aatatgtatc ataaacgggt gtttgaaaaa      1200
     ggctatgatc caaatgatgt gatgagatcg atcttagcca aaagccggga tcacgcccgg      1260
     accccgatgc agtggaacag cggcaaaaat gccggattta ctgacggcac gccttggctg      1320
     aaggtcaatc cgaacttcac cgcaatcaat gtggaggaag cgcagggaga tcctgattct      1380
     gtcttaaact attacaaaaa gctgatcagc ctgagaaagc agtacgctga cctcatgaaa      1440
     gggagctttg atcttttgct tccggacgat ccgcagttgt ttgtatacat gagagaaaac      1500
     agtaaacaac agcttttgtc ggtcaataat ttttcaaaag agcaggctgt ttttcagtgg      1560
     cctaagaact gcggcaaagc tcaggcctca ctgcttctca gcaattataa caacgatgat      1620
     cttgatgacg aaatggtgtt ccggccttat gagagcaggg tctatcttct ggacaaaaca      1680
     aactaa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page