(data stored in ACNUC7421 zone)

EMBL: AL009126.YCEB

AL009126.YCEB        Location/Qualifiers
FT   CDS_pept        complement(310880..311875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /locus_tag="BSU_02880"
FT                   /old_locus_tag="BSU02880"
FT                   /product="putative luciferase-like monooxygenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 16428414; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12082"
FT                   /db_xref="GOA:O34504"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="SubtiList:BG12766"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34504"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12082.2"
FT                   /translation="MIHLSILDQAPVSKGESPVTTLQHSVELAQLSEQWGYKRYWFAEH
FT                   HSTKGLASTAPEIMIARIAAQTNTIRVGSGGVLLPQYSPFKVAETFRQLEALYPNRIDL
FT                   GVGRSPGGTTKTRLALTDGVKKSLTEFNRQLQDVSYFLTDSLPPDHPYAGIKAAPLIGT
FT                   APELWVLGLGENSARRAAHQGIGYVFGHFINPERGENAFRIYRESFRPSAHFSNPSALF
FT                   TIFVICAKTDEEAEELALSQDLWLLRVGKGLDSRVPSIEEAKAHPYTASDKKLIEENRK
FT                   RMVIGSPTTVKQQLLDLTGCYETNEIMVLCNVFDFEAKKESYERLAELFL"
     ttgattcatt taagcatact tgatcaggca cctgtttcta aaggagaaag ccctgtgaca        60
     actctccagc attcggttga gcttgcccaa ttaagcgaac agtggggcta taagcgttat       120
     tggtttgccg agcatcacag cacgaaagga ctggcaagca cagcgcctga aatcatgatc       180
     gcccgcatcg cagcacagac aaacaccatt cgtgtcggat caggcggcgt gcttctgccc       240
     caatacagcc catttaaagt ggctgaaacc tttcgccagc ttgaggccct gtatccaaac       300
     cggattgacc tcggcgtcgg tcgctccccc ggcggcacga caaaaaccag acttgcatta       360
     acggacgggg tgaaaaaaag cttaaccgaa tttaacagac agctgcagga tgtctcttat       420
     tttctaacag attcccttcc tcccgaccat ccgtatgccg gaatcaaagc ggcgcccctt       480
     attggtacgg cacccgagct atgggtgctc ggtcttggtg aaaacagcgc aagacgcgcg       540
     gcgcaccagg ggattggata tgtatttggg catttcatta atcccgagcg aggagaaaat       600
     gcattccgca tctaccggga aagctttcgg ccctcagccc atttttcgaa tccatccgca       660
     ctgtttacga tttttgtcat ttgcgcaaaa acagatgaag aggcagaaga actcgcatta       720
     agccaggatc tgtggcttct tcgcgtcgga aaaggcttgg acagccgcgt gccaagcatc       780
     gaggaagcga aagctcatcc ctatacagcg tccgataaaa aactcataga agaaaacaga       840
     aagcggatgg tgatcggttc tcccaccact gtcaaacaac agctgttaga cctcacaggc       900
     tgctacgaaa caaatgaaat catggttctg tgcaatgtgt ttgattttga ggcgaaaaaa       960
     gaatcttatg agcgccttgc cgaattgttt ctataa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page