(data stored in ACNUC7421 zone)

EMBL: AL009126.YCEC

AL009126.YCEC        Location/Qualifiers
FT   CDS_pept        312159..312758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="BSU_02890"
FT                   /old_locus_tag="BSU02890"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 24366250; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12083"
FT                   /db_xref="GOA:P81100"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81100"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12083.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKLMVGLGWDPVSSGGGFFSKLLGG
FT                   GGPNIDCDASVLMLENGKFTDKKNLIYFGNLKSRCGGVQHTGDNLTGDGAGDDEQIMID
FT                   LDKVPGNIDKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQSNHEEMLKYNLRDNYAGRT
FT                   SLITAEIYRSGSEWKFAAVGEGTNDTRLEDIISRYV"
     gtggcaattt ctttagaaaa aggtcaacga attgatttaa caaaaggaaa agccggtctg        60
     tcaaaattga tggtcggtct cggctgggac ccagtgtcct caggcggagg attcttcagc       120
     aaactgcttg gcggaggcgg tccgaatatc gactgtgacg cttcagtgct gatgctggaa       180
     aacggaaaat tcaccgataa gaaaaacctg atttatttcg gcaacctgaa aagccgctgc       240
     ggcggtgtac agcatacagg cgacaacctg acgggtgacg gtgcgggcga tgacgagcaa       300
     attatgatag atttagataa agtgcctgga aacatcgata agcttgtatt tgtagtgaac       360
     atttacgatt gtgtcagaag aaaacaagat ttcggcatga ttcaaaatgc gtttatccgc       420
     gtagttgatc aatctaatca cgaggaaatg ctcaagtaca atttgagaga caattacgcc       480
     ggcagaacaa gcctgattac agcagaaatc taccgcagcg gcagtgagtg gaagtttgcg       540
     gcggtcggtg aaggcacaaa cgatacgaga ttagaagata ttatcagtcg atacgtataa       600
//

If you have problems or comments...

PBIL Back to PBIL home page