(data stored in SCRATCH zone)

EMBL: AL009126.YCED

AL009126.YCED        Location/Qualifiers
FT   CDS_pept        312780..313361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="BSU_02900"
FT                   /old_locus_tag="BSU02900"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12084"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80875"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12084.1"
FT                   /translation="MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSS
FT                   VFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANID
FT                   KISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYR
FT                   HNGEWKFSAIGSGYQGGLARIATDYGLQVG"
     atgacaattt cattggcaaa aggacaaaaa gtagatttaa caaaaacaaa tccgggtctt        60
     tcaaaggttg ttgtcggttt aggctgggat acgaacaagt atgacggcgg gcacgacttt       120
     gatcttgact caagtgtgtt tctgttagac gccgcgggca aatgcgcgtc accaaacgac       180
     tttattttct acaaccagct tgaaggcggc aacggttcag tcgttcattc aggcgacaac       240
     ctgactggtg ctggcgaagg cgacgatgag aatgtaaaag taaatctcag cgctgtaccg       300
     gcaaacattg ataaaatctc atttgttatt accattcacg atgcagaagc gcgcagccaa       360
     aactttggac aagtatcaaa cgcgtttgtc cgcatcgtaa atgaagaaac aaatgaagag       420
     ctcatccgtt acgatcttgc agaagatttc tctattgaaa cggcaatcat tgcaggggag       480
     ctttacagac ataacggcga gtggaaattc tcagcaatcg gctcaggcta ccaaggcggc       540
     cttgcccgca ttgcaacaga ctacggtttg caagtcggtt aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page