(data stored in ACNUC7421 zone)

EMBL: AL009126.YCEE

AL009126.YCEE        Location/Qualifiers
FT   CDS_pept        313396..313974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="BSU_02910"
FT                   /old_locus_tag="BSU02910"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250,
FT                   25355936; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12085"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12769"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34384"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12085.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDAS
FT                   AFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIE
FT                   KIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYR
FT                   HGGEWKFNAIGSGFSGGLAALCRNYGLQV"
     atggccattc aattatcaaa aggacagcgc attgatttaa caaaaacaaa tccgggactg        60
     actaaagcgg tgatcggctt aggctgggat acaaacaagt actccggcgg acacgatttt       120
     gacctggatg cttcggcctt tttagttgat gcgcatgata actgcgtaaa tgatctcgat       180
     ttcgtcttct ataataacct tgaacatccg agcggcggtg tcatccatac gggtgacaac       240
     cgcacgggtg agggcgacgg agatgatgag cagattatcg ttgatttctc aaaaatccct       300
     gctcacattg agaaaatcgg catcacagtg accattcacg acgctgaagc acgcagccaa       360
     aactttggac aagtttccaa tgcatttgtc cgcgttgtgg atgaagaaac gcagaatgag       420
     cttcttcgct tcgatttggg agaagacttc tccattgaaa cagctgttgt cgtttgtgag       480
     ctttacagac acggcggcga gtggaaattc aatgcaatcg gcagcggatt ttccggcggg       540
     ctggctgcat tgtgccggaa ttacggtttg caagtgtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page