(data stored in ACNUC7421 zone)

EMBL: AL009126.YCEG

AL009126.YCEG        Location/Qualifiers
FT   CDS_pept        314883..316496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="BSU_02930"
FT                   /old_locus_tag="BSU02930"
FT                   /product="putative toxic compound adaptation protein
FT                   (tellurite resistance)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 24366250; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12087"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="SubtiList:BG12771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34809"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12087.1"
FT                   /translation="MRQEELTIHKALPADGDWKSLLFQPLPERDHYETAQGLSFSRLAG
FT                   QILGTPIDETDYYNELYELSVNDRITILSETLDKTIEPETFQKLQHIHSINQKEKGLSV
FT                   SRFVAFLDGEKLIAKHSNPLMHRHLRKALMTLLHTFADSHEKGLNHPDFRRVLLDVSKF
FT                   SLNHLNPWLEKTDIEREMPKVVWYGDATKSQLYFLYYLMLVGCDVLLFHPAGTDQLALV
FT                   DPKQELGFTEKLPDVSELQPFPKEKPDRKSTVAYRSTKEIEHVLNHEESMLYKPWQFRD
FT                   HTPVSVTLKTTYDELFLITKERAFIRPNFKADKHSIEIPNVFAKIMGVSKDNKEYWNRL
FT                   HTLADYQETEMVRSFPFTEEIKSNYQFHYSHALDQEGNIDPDKLMASNVWQYKQLPAGV
FT                   QTAIAKTISRMCRYPRLKALHQEQVKDVQIYLFKQTTNLPANLLKLIQMFDYAQTVPKL
FT                   VLYHTEMSGGLTRSDAAALLFLNEIGIDIIIYNPPGHQDIEQFIEEDQYDIHWLDDMVF
FT                   QQDYKEPSLVKRLFRTITQK"
     atgagacaag aagaactaac cattcataaa gcacttccgg ctgatggcga ttggaaaagc        60
     ctgctgtttc agccattgcc ggagcgggat cactatgaaa ctgcacaagg cctttctttt       120
     tctcgtcttg ccggtcagat attgggcacg cctattgatg agacggacta ctataacgag       180
     ctgtatgagc tgtctgtaaa cgaccgcata acgattttga gtgaaacgct tgataaaaca       240
     atcgaaccgg aaacatttca aaagcttcag catattcatt ccatcaatca gaaagaaaaa       300
     gggctgtcag tcagccgctt tgttgccttt ctggacgggg aaaagctgat tgcgaagcac       360
     tcaaatccct tgatgcaccg ccatttaaga aaagcgttga tgacgctttt acataccttt       420
     gcggacagtc atgaaaaggg gctgaatcat cctgattttc gcagagtgct gcttgatgtc       480
     tcgaagtttt ccttaaacca tctgaaccct tggctggaaa aaaccgatat agagcgggag       540
     atgccgaagg ttgtttggta tggagatgcg acgaaaagcc agctctattt cttatattat       600
     ctgatgctgg tcggctgtga tgtactgctg ttccatccgg cgggaacgga tcagctggcg       660
     cttgtcgacc cgaagcagga gctcggtttt acggaaaagc tcccggatgt ttcggagctt       720
     cagccgtttc cgaaagaaaa accagaccgg aaatcaacag tggcttaccg ctcaacaaag       780
     gaaattgaac atgtgctgaa tcacgaggaa tccatgctat ataagccgtg gcagttcaga       840
     gatcacacac cggtgtccgt tacgctgaaa acgacctatg atgaattgtt tttaatcacg       900
     aaagaacgcg cctttattcg gccgaatttc aaagctgata aacattccat tgagattccg       960
     aatgtattcg ccaaaattat gggcgtgtcg aaagacaata aggaatattg gaacaggctt      1020
     catactctag cggattatca ggaaacagaa atggtcagaa gctttccatt tacagaagaa      1080
     ataaagtcga actatcaatt tcactacagc cacgcacttg atcaagaagg gaacattgat      1140
     ccggacaagc tgatggcaag caatgtgtgg cagtacaaac agctgccggc gggcgttcag      1200
     actgccattg ccaaaacgat ttcgagaatg tgcaggtacc cgcggcttaa agccttgcat      1260
     caggaacaag tcaaggatgt tcaaatctat ttgtttaaac aaacaacaaa cctgcctgct      1320
     aatctgctga aattgattca aatgttcgac tatgcgcaaa ccgttccgaa actcgtttta      1380
     tatcatacgg aaatgagcgg cggactcacg cgttcggatg ctgccgccct gctgttcctg      1440
     aatgaaatcg gaatcgatat catcatttat aatccgcccg gacaccaaga tattgagcag      1500
     tttattgaag aggatcagta tgatatccac tggctggatg acatggtgtt tcagcaggac      1560
     tacaaagagc cttcgcttgt gaaaaggctc ttcagaacca ttacccaaaa ataa            1614
//

If you have problems or comments...

PBIL Back to PBIL home page