(data stored in ACNUC7421 zone)

EMBL: AL009126.YCEH

AL009126.YCEH        Location/Qualifiers
FT   CDS_pept        316512..317603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /locus_tag="BSU_02940"
FT                   /old_locus_tag="BSU02940"
FT                   /product="putative reactive oxygen species resistance
FT                   protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12088"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="SubtiList:BG12772"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34833"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12088.1"
FT                   /translation="MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLAQQIDVK
FT                   NQMELLEYGKEPAVEISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKG
FT                   LMAKIFKRGGSMIEKIFKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYY
FT                   MELEKYVVAGQMKLEEMQSILPSYEEKAASGNQLAQMQLDTLRNGIQALEERVYDLDMA
FT                   RMVALQTAPQIRLLQRGNAKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSEL
FT                   DRRTNEMLKRNAENISSQSVEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKR
FT                   LREDGARRIAQLQDNIKKAALQQ"
     atgacaacag aaaatcaaaa tccgcttgtt ctcgataaaa atgaagagat ttcccagcaa        60
     aaagctgacg atatccgtct tcagctccgt caggaaccag aagtgaagcg gcttgctcaa       120
     caaattgacg tcaaaaacca aatggagctg cttgagtacg gcaaggagcc ggccgttgaa       180
     atatccaagt tctctgaccg catcttgggg atgatgaaaa caacaagcgt gacagactcc       240
     ggcacaatgc tgactcagct tgggaaaatc atggaccgct tcgacaaaaa tgattttgat       300
     gagccaaagg gattaatggc gaaaattttc aaacgcggcg gcagcatgat tgaaaaaatc       360
     tttaaaaagt atcagacgct tggcggagag attgaaaaaa tccacgttga gatttcaaaa       420
     tacaaagatg agatgacgaa gacgaactac acgctcgatg aaatgtatga aaacaatatc       480
     aaatactata tggagcttga aaaatacgtc gttgccgggc agatgaaact ggaagagatg       540
     cagtcgatcc ttccttcata tgaggaaaaa gcggcaagcg ggaaccagct ggcgcaaatg       600
     cagctcgata cgttgcgcaa cggcattcag gcgcttgagg aacgggtgta tgatcttgac       660
     atggcacgga tggtggcgct tcaaaccgca cctcaaatcc gtctcctgca gcgaggaaat       720
     gcaaagctga tcgggaaaat caactccgcg tttatcatta ccattccgat tttcaaaaac       780
     ggcattattc aggctgttac ggtaaagcgg caaaagcttg tggctgattc catgagcgag       840
     cttgaccgcc ggacaaacga gatgctgaaa cgaaatgctg aaaacatctc gagccaaagt       900
     gttgaaattg cgagaatggc cggcagaccg agcatagata ttgaaacgat tgaatcgtct       960
     tggaacacga ttgtcagcgg catgcaggaa acaaaacaaa tcgaagaaga aaacaagcgc      1020
     ctccgcgaag acggcgcgag acgaattgcc cagcttcagg ataatattaa aaaagcagca      1080
     ttgcagcaat aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page