(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGA

AL009126.YCGA        Location/Qualifiers
FT   CDS_pept        325339..326772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /locus_tag="BSU_03020"
FT                   /old_locus_tag="BSU03020"
FT                   /product="putative branched chain amino acid permease"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   21747963, 21764931; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12096"
FT                   /db_xref="GOA:P55908"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="SubtiList:BG11999"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55908"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12096.2"
FT                   /translation="MSMPAAETQPKKKRMTFKMPDAYVLLFMIAFICAIASYIVPAGEF
FT                   DRVTKGDVTTAVPGSYHSIEQSPVRLISFFTSLQDGMVGSAPIIFLILFTGGTIAILEK
FT                   TGAINGLIYNVISKFRTKQLLFICIVGALFSILGTTGIVVNSVIGFIPIGLIVARSLKW
FT                   DAVAGAAVIYIGCYAGFNSTILSPSPLGLSQSIAELPLFSGIGLRVVIYICFLLSSIIY
FT                   IYLYTRKLKKSKDASVLGTDWFPAAGMGEAGKEEDQSVPFTVRHKLILAVAGLSLVGFL
FT                   YGALKLGWSDSQMAATFIFISVLAGLIGGLAANDIAKTFITGCQSLVYGALIVGMARSI
FT                   SVILENGKLLDTVVNALASLLDGFSPIAGAIGMYIASALLHFLISSGSGEAVVFIPILA
FT                   PLADLMGITRQVAVEAVMLGEGVVNCVNPTSGVLMAVLAASGIPYVKWLRFMVPLALIW
FT                   FLIGLVFIVIGVMINWGPF"
     atgagtatgc cagcagccga aacacagcct aagaaaaaac gtatgacatt taaaatgcct        60
     gacgcctatg tcctcttatt tatgattgct ttcatttgcg caatcgcttc atatattgtg       120
     ccggcaggtg aatttgaccg cgtgacaaag ggggatgtca cgaccgctgt tccgggaagc       180
     tatcattcaa ttgaacagtc tccggtcaga ttgatcagct tttttacttc tctacaggat       240
     ggaatggttg gatcagcacc catcatcttt ctgattttat tcacaggcgg caccattgct       300
     attctagaaa aaacgggtgc catcaatggc ctgatttaca atgtcatcag caaattccgc       360
     acaaagcaat tattatttat ttgtattgtc ggcgcattgt tctccattct cggaacaacc       420
     gggattgtcg tgaattcagt tatcggtttt atccccatcg gcctcattgt ggcacgatcc       480
     ttaaaatggg acgcagtcgc gggagccgct gttatataca tcggctgcta cgctggattt       540
     aactccacca tattatcacc gtcaccgctc ggtttatcac aatcaatcgc ggagctccct       600
     cttttctcag gaatcggcct gcgagttgtg atatacatat gctttttgct gtcttctatt       660
     atttatatct atttgtatac gagaaaatta aaaaaatcaa aagatgccag tgtgttagga       720
     acagattggt tccctgcggc aggaatgggc gaagccggta aagaagaaga tcagtcagtg       780
     ccgtttaccg ttcgccataa gctgattttg gctgtggcgg gactctcact tgtcggattt       840
     ttatacggcg ctttgaagct tggctggtca gattcccaaa tggctgcgac atttattttt       900
     atttctgtcc ttgccggttt aataggcggg cttgcggcga acgatattgc caaaaccttc       960
     attacgggct gccaaagtct tgtatacggg gcgctgattg tcgggatggc acgaagcatt      1020
     tccgttatcc ttgaaaatgg aaagcttctc gatactgtcg tcaatgcttt ggcttcactt      1080
     ttggatggat tcagcccgat tgctggggca atcggcatgt atatcgccag tgcgctgctt      1140
     cattttctca tctcttcagg ttctggcgaa gccgttgtat ttattccaat cctggcgccg      1200
     ctcgctgatt tgatgggaat cacgagacag gttgcggttg aagcggttat gcttggagaa      1260
     ggggtcgtca actgtgtgaa cccgacatcc ggcgttctca tggcggtgct tgccgccagc      1320
     ggtattccgt atgtcaagtg gctgcggttt atggtgccgc ttgctctgat ttggttcttg      1380
     atcgggcttg tctttatcgt gatcggagtc atgatcaatt gggggccgtt ttaa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page