(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGB

AL009126.YCGB        Location/Qualifiers
FT   CDS_pept        326888..327469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="BSU_03030"
FT                   /old_locus_tag="BSU03030"
FT                   /product="putative integral inner membrane protein of
FT                   unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406, 22720735; Product
FT                   type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12097"
FT                   /db_xref="SubtiList:BG12000"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55909"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12097.2"
FT                   /translation="MNNLRNRLSGVNGKNKRVKEKEQKIWSEIGMIAGAFALLDVIIRG
FT                   IMFEFPFKEWAASLVFLFIIILYYCIRAAASGMLMPRIDTKEELQKRVKQQRIESIAVA
FT                   FAVVVLTMYDRGIPHTFFAWLKMILLFIVCGGVLFLLRYVIVKLAYRRAVKEEIKKKSS
FT                   FLFGKRGKRSQFRAAFFIGTLICIHSAKLF"
     atgaataatc tgcgtaatag actttcaggc gtgaatggga aaaataagag agtaaaagaa        60
     aaagaacaaa aaatctggtc ggagattggg atgatagcgg gagcatttgc gctgcttgat       120
     gtgatcatcc gcggcattat gtttgaattt ccgtttaaag aatgggctgc aagccttgtg       180
     tttttgttca tcattatctt atattactgc atcagggctg cggcatccgg aatgctcatg       240
     ccgagaatag acaccaaaga agaactgcaa aaacgggtga agcagcagcg aatagaatca       300
     attgcggtcg cctttgcggt agtggtgctt acgatgtacg acagggggat tccccataca       360
     ttcttcgctt ggctgaaaat gattcttctt tttatcgtct gcggcggcgt tctgtttctg       420
     cttcggtatg tgattgtgaa gctggcttac agaagagcgg taaaagaaga aataaaaaag       480
     aaatcatctt ttttgtttgg aaagcgaggg aagcgttcac agtttcgggc agcttttttt       540
     ataggaacat tgatttgtat tcactctgcc aagttgtttt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page