(data stored in SCRATCH zone)

EMBL: AL009126.YCGG

AL009126.YCGG        Location/Qualifiers
FT   CDS_pept        335329..336090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgG"
FT                   /locus_tag="BSU_03100"
FT                   /old_locus_tag="BSU03100"
FT                   /product="conserved protein of unknown function (similar to
FT                   phage protein)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12104"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="SubtiList:BG12005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94382"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12104.2"
FT                   /translation="MVNGIYTKSFLERIQEELPEWQRIAFELLAETLGDDADTFPCIPG
FT                   RQAFLTDQLRIAFAGDPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEH
FT                   YSIEAYEELFWRFLNRLSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFILCATPGHEAR
FT                   RSRSFPFFMVTFQPRWVFDDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDN
FT                   REWKQYFLRDDEKQVSKCPFSYLKNMFNKMK"
     atggtgaatg ggatttacac caaaagtttt ctggaacgta ttcaggaaga gcttcctgaa        60
     tggcaaagaa tcgcttttga gctgctggca gaaactctgg gggacgacgc ggatacattt       120
     ccgtgcattc ccggacgcca ggcgtttctg actgatcagc ttcggattgc ttttgccgga       180
     gatccgcggg aaaaccgcac agcggaggaa ctggctccgt tgcttgcgga gtacggcaag       240
     atatcgcggg acacgggaaa atacgcatcc ctcgttgtgt tgtttgatac accggaagat       300
     ttggcggagc attattcgat tgaagcgtat gaagagctgt tttggcgctt tttaaataga       360
     ctgagtcatc aagacgaaaa agaatggccg gaagacattc cggccgatcc tgagcattat       420
     aaatgggagt tttgttttga cggcgagccg tatttcattc tgtgcgctac accggggcac       480
     gaggcaagaa gaagccggag ctttcctttt tttatggtca cgtttcagcc aaggtgggtg       540
     tttgatgacc taaatggatc aactgcattt ggccgtaaca tgagcaggct gatccgatct       600
     cgtttagagg cctatgatca ggctccgatt cacccgcaat taggctggta cggaggaaaa       660
     gataatcgtg aatggaagca gtatttcctc cgtgatgacg aaaaacaggt atcgaagtgc       720
     ccgttttctt atttaaagaa catgttcaac aaaatgaaat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page