(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGH

AL009126.YCGH        Location/Qualifiers
FT   CDS_pept        complement(336092..337432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="BSU_03110"
FT                   /old_locus_tag="BSU03110"
FT                   /product="putative amino acid transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12105"
FT                   /db_xref="GOA:P94383"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG12006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94383"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12105.2"
FT                   /translation="MSQTKKDQPKGNLAWWQLSLIGVGCTIGTGFFLGSSIAIVKSGFS
FT                   VLLSFLIAGIGTYFVFEQLAKLSAKQPEKGSFCAYARKAFGKWAGFSNGWVYWTSEMLI
FT                   TGSQLTAISLFTKHWFPQVPLWVFASIYAVLGLLIIFTGLSVFEKTENVLAVIKTAAIF
FT                   MFIVIAILALCGILSGGNHGIHVPNKTSEFFPYGAMGLWTGLIYAFYAFGGIEVMGLMA
FT                   VHLKKPEEASKSGKLMLATLAIIYIISIGLALLLVPLHTFTEQDSPFITSLKGYNLEII
FT                   LDIFNGIFIIAGFSTLVASLFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAG
FT                   LVLSIILSLVLPKNIYEHMTTAAGLMLLYTWLFILFSSKKLTDPEGMGKTQIYLAMVLI
FT                   AAAVSGTLFEKSSRPGFFVSIGFLVIIAIVTMIYQKKQGHKDRPASP"
     atgagccaaa caaaaaaaga ccagccaaaa gggaatctgg cttggtggca gctgtcactg        60
     atcggagtcg gctgcacgat tggaacaggc ttctttctcg gttccagcat cgcaattgta       120
     aaaagcggtt tttccgttct cctttcattt ctgatcgcag ggatcggtac gtattttgtc       180
     tttgaacagc tcgccaagct atcggcgaag cagccggaaa agggctcgtt ttgtgcgtat       240
     gcccgaaaag cattcggcaa atgggcaggc ttcagcaacg gctgggtgta ctggacatca       300
     gaaatgctga ttaccggaag ccagctgaca gccatttcgc tctttacgaa gcattggttt       360
     cctcaagtgc cgctatgggt gtttgcctca atctacgcag tacttgggct ccttattatt       420
     ttcaccggcc tgtccgtctt tgaaaaaaca gaaaacgtgc tggcagtcat taaaacagct       480
     gctattttta tgtttattgt cattgccatc ctggctttat gcggtatcct gtccggcgga       540
     aatcatggca tacatgttcc aaataagacg agtgagtttt tcccatacgg cgccatgggg       600
     ctgtggacag gtttaatcta cgcgttttac gcttttggcg gaattgaggt catggggctg       660
     atggcggttc acttaaaaaa acctgaggaa gcgtctaaat cagggaaact gatgctggcg       720
     acgctggcga ttatttatat catttcaatc gggcttgctc tgcttttggt tccgttacac       780
     acgtttactg aacaggacag tccgttcatt acgtcattaa aaggatataa ccttgagatc       840
     atccttgata tatttaacgg gattttcatc atcgcagggt tctcgaccct tgtcgcttcg       900
     ctatttgcgg ttacgacatt gctttgtaca atggctgatg acggcgacgc gccgaaatgc       960
     tttactctaa aggaaggcaa aaaaatatgc tggccggcac ttgggctgac gtttgcgggg      1020
     cttgtcctct ccattatttt gtcgttagtg ctgcctaaaa acatttatga gcatatgaca      1080
     acagctgcgg ggcttatgct tttatacact tggctgttta tcctgttctc cagcaaaaag      1140
     ctgactgatc ccgagggcat gggaaaaacg caaatttatt tagcgatggt tctgattgct      1200
     gcagctgtgt ccggtacatt gtttgaaaaa tcaagccggc ccggtttttt cgtcagcata      1260
     ggttttctcg tgattatcgc catcgttacc atgatctatc aaaaaaagca gggtcataaa      1320
     gatcgccctg ccagtccttg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page