(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGI

AL009126.YCGI        Location/Qualifiers
FT   CDS_pept        337562..338158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgI"
FT                   /locus_tag="BSU_03120"
FT                   /old_locus_tag="BSU03120"
FT                   /product="xenotiotic metabolite methyltransferase"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 16433904, 28898812; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12106"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="SubtiList:BG12007"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31473"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12106.3"
FT                   /translation="MTQQYIVEPKKGLGLKLKKGQILKVVDVEGQQVADFVAYHAKDFY
FT                   EHLDQGATIDANHSIHVKVNDHLYSNLYKPMLTLIEDTVGKHDLLLPACRPDMNRLLYG
FT                   KQKDEFQDTCYDNMNRALEQFGVPKPHMHYPFAIFMNTVLDEKGNLSVETPLSNAGDYV
FT                   RLRAEMDLIVAFSSCPIEKGKCNGDSVTSIRVEVS"
     atgacacagc aatatattgt ggagccgaaa aaagggcttg ggctgaagct gaaaaagggg        60
     cagattttaa aggtggttga tgtagaaggg cagcaggtgg ctgattttgt cgcataccat       120
     gccaaggatt tttatgaaca ccttgatcag ggagcgacga tagacgccaa tcactccatt       180
     catgtgaagg tcaacgacca tctctactcc aacctgtata agccgatgtt aaccctgatt       240
     gaagatacgg tcggcaagca tgatctgctg ttgcccgcct gccgtcctga tatgaacagg       300
     ctcttatatg ggaagcaaaa ggatgagttt caggatacgt gctatgacaa tatgaaccgt       360
     gcgcttgagc agtttggcgt accgaagccc cacatgcatt acccatttgc gatttttatg       420
     aatactgtcc ttgatgagaa agggaatctg tctgtggaaa cgccgctttc gaatgccgga       480
     gattatgtaa ggctcagggc ggagatggat ttaattgtcg cgttttcttc ctgcccgatt       540
     gaaaaaggga aatgcaatgg cgacagtgtg acatccatac gggttgaagt cagctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page