(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGL

AL009126.YCGL        Location/Qualifiers
FT   CDS_pept        343578..344360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /locus_tag="BSU_03190"
FT                   /old_locus_tag="BSU03190"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12113"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="SubtiList:BG12010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94389"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12113.1"
FT                   /translation="MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFI
FT                   YVPKKEWYFSIEQERDVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYE
FT                   AFTTAEQLRKLRTEAFKPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQW
FT                   IEKHGTIPPMDFTVLMNELVAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEI
FT                   ERIMEAAKELKAEKKDMTSELNRLLLNTVEEVWKDGGS"
     atgaaacaaa gaatcattga tgaattaaaa cggatcgagc agtcatacgg agtcaaaatc        60
     gtgtatgccg tcgagtcagg aagccgcgca tggggatttc cctcgcagga tagtgattac       120
     gacgtccgct ttatttatgt tccgaaaaag gagtggtact tttcaattga gcaggagcgt       180
     gatgtcattg aggaaccgat tcacgatttg ctggatatca gcggctggga gctgagaaaa       240
     acgcttcggc ttttcaaaaa gtcaaaccct ccgctactcg aatggctgtc ctcagacatt       300
     gtgtattatg aagcatttac gaccgcagag cagttaagaa aactccgcac ggaggcattt       360
     aagcctgaag caagcgtgta tcactatatc aatatggcga gaaggaacgt caaggattat       420
     ctacaaggac aagaggtcaa aattaaaaag tacttctacg ttcttcggcc tattttggcc       480
     tgccaatgga ttgaaaagca cggaaccata ccgccaatgg actttactgt tttgatgaat       540
     gaacttgttg ctgaacccga gctgaaggct gaaatggaaa ccttgcttga acggaaaaga       600
     agaggggaag agcttgacct cgaagcaaga atcgatgtta ttcaccaatt cattgaaacg       660
     gaaatcgaaa gaatcatgga agcggcaaaa gaactgaagg cagagaaaaa agatatgaca       720
     tctgaattga accgtttgct tttgaatacg gttgaagaag tgtggaagga tggaggaagc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page