(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGQ

AL009126.YCGQ        Location/Qualifiers
FT   CDS_pept        complement(349996..350853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ"
FT                   /locus_tag="BSU_03240"
FT                   /old_locus_tag="BSU03240"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12118"
FT                   /db_xref="GOA:P94394"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="SubtiList:BG12015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94394"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12118.1"
FT                   /translation="MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAIL
FT                   TAVQAYLFIKSPEKSGHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYVVFLFPLVSGIFF
FT                   PIATLDSSIVKTKGFSFKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSK
FT                   KEISLTDDDFLKGMETIYNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIAD
FT                   SGVYGMLVEFPKDMDIKDDEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYV
FT                   YRGF"
     atgtttcgtt tattggtgct gatgggattt acgtttttct tttatcatct gcatgcctca        60
     ggaaatctaa caaaatatat caatatgaaa tatgcctatc tttcctttat tgcgatcttc       120
     ctgctggcca ttctgaccgc cgtccaagca tatctattta tcaagtcgcc tgaaaaaagc       180
     ggacatcacc atgaccatga ttgcgggtgc ggccatgatc acgagcatga ccatgaacaa       240
     aacaagccat tttatcagcg ttatttgatt tatgttgttt ttctttttcc tttggtgtca       300
     ggcatcttct tcccgattgc aacgcttgac tcatccatag tcaaaacaaa agggttctcg       360
     tttaaggcga tggagagcgg agatcactac tcccaaacac agtatttgcg gcctgatgcc       420
     agcctttatt acgcgcaaga cagctatgac aaacaaatga aacagctgtt taataagtat       480
     tccagcaaaa aagagatttc tctgaccgat gacgatttcc taaaaggaat ggaaaccatc       540
     tataactatc cgggtgaatt tctcggacgg acgatagaat ttcatggatt tgcttacaaa       600
     ggaaacgcaa ttaacaaaaa tcagctgttc gtattaaggt ttggcatcat tcactgtatc       660
     gctgattccg gcgtgtacgg gatgcttgtg gaatttccga aggacatgga catcaaggat       720
     gatgaatgga ttcacattaa gggcactctg gcctcagaat attaccagcc attcaagtca       780
     actctccctg tcgtcaaagt aactgactgg aataccatta aaaaacctga tgatccgtat       840
     gtttacagag gattttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page