(data stored in SCRATCH zone)

EMBL: AL009126.YCGS

AL009126.YCGS        Location/Qualifiers
FT   CDS_pept        complement(351842..352696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgS"
FT                   /locus_tag="BSU_03260"
FT                   /old_locus_tag="BSU03260"
FT                   /product="putative aromatic hydrocarbon hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.7.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12120"
FT                   /db_xref="GOA:P94396"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12017"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94396"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12120.1"
FT                   /translation="MKRRVETITFDGGTLEYSVTGKGTPILVMHGGHSNCYEEFGYTAL
FT                   IEQGYSIITPSRPGYGRTSKEIGKSLANACRFYVKLLDHLQIESVHVIAISAGGPSGIC
FT                   FASHYPERVNTLTLQSAVTKEWLTPKDTEYKLGEILFRPPVEKWIWKLISSLNNAFPRL
FT                   MFRAMSPQFSTLPFQRIKSLMNEKDIEAFRKMNSRQRSGEGFLIDLSQTAAVSLKDLQA
FT                   IICPVLIMQSVYDGLVDLSHAHHAKEHIRGAVLCLLHSWGHLIWLGKEAAETGSILLGF
FT                   LES"
     atgaaaagac gagttgaaac gatcaccttc gatggcggta cactagaata ttctgtgaca        60
     ggcaagggaa ctccgatcct tgtcatgcat ggcgggcatt caaattgtta cgaggaattc       120
     ggatacacag cgttgattga acaagggtat tccatcatta cgccttcaag gcctggctat       180
     ggacggacgt caaaagaaat tggaaaaagt cttgccaatg cctgccgttt ctatgtgaaa       240
     ttattagatc atctacaaat cgagagtgtc catgtgatcg ccatctcagc aggagggccg       300
     agcggcatat gctttgcctc acattatccg gaaagagtaa atacattgac cctgcaatcc       360
     gcagtcacca aagagtggct caccccaaaa gacactgaat ataaattggg ggaaattctc       420
     ttccgcccgc cggtggaaaa gtggatatgg aagctgattt cttccttgaa taacgctttc       480
     ccgcgtttga tgtttcgagc tatgagcccc caattcagca cgcttccgtt tcagcgaatc       540
     aagtccttga tgaatgaaaa agacatagaa gcatttcgga aaatgaacag ccggcagcgc       600
     tcgggtgaag gatttctgat tgacttgtca caaaccgccg ctgtctcttt aaaagacctg       660
     caagccatca tatgtcccgt gctgattatg caaagtgttt atgacggatt ggttgacttg       720
     tcacatgcac atcatgcaaa agagcacatt cgtggcgctg ttctctgttt gcttcactca       780
     tggggacacc tgatttggct cggaaaagaa gctgcagaaa caggcagtat cctactcggc       840
     tttttggaat cctaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page