(data stored in ACNUC7421 zone)

EMBL: AL009126.YCKA

AL009126.YCKA        Location/Qualifiers
FT   CDS_pept        complement(367305..367985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="BSU_03370"
FT                   /old_locus_tag="BSU03370"
FT                   /product="aminoacid ABC transporter (permease subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 15849754, 16850406,
FT                   23038252; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12131"
FT                   /db_xref="GOA:P42399"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="SubtiList:BG11177"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42399"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12131.1"
FT                   /translation="MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIG
FT                   LFISLARMSKLALLRWPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFS
FT                   LNSAAYIAEINRSAISSVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLD
FT                   LIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKY
FT                   AHYV"
     atgatcaata gcattcagtg ggaatatatt ttcaacacga agctggccat tgaatcgttc        60
     ccttatgtca taaaaggcat tggttataca ctgctcatct cttttgtaag catgtttgcg       120
     ggaactgtga tcggcctgtt catatcactc gccagaatgt ctaaacttgc tttgttaaga       180
     tggccggcga agctctatat ctcatttatg cgaggcgttc cgattttggt gattttgttt       240
     atcctttatt tcgggtttcc ttatatcggc attgaatttt ccgctgtcac ggctgcttta       300
     atcggcttta gcctaaacag cgccgcctac attgcggaaa ttaaccgttc agccatttca       360
     tccgtcgaaa aaggacagtg ggaagccgca tcctcgctgg gtctttccta ttggcagacg       420
     atgaggggca tcattttgcc gcaatcgata cgtattgcgc tgcctccgct tgccaatgta       480
     ttgctcgact tgatcaaggc gtcctctctc gctgcgatga ttacagtgcc ggaattgctc       540
     cagcatgcga aaatcatcgg gggcagagag tttgattata tgaccatgta tattctgacc       600
     gctctcattt attgggccat ctgctccatt gccgcggtct ttcagaatat ccttgagaaa       660
     aaatacgctc attatgttta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page