(data stored in ACNUC7421 zone)

EMBL: AL009126.YCKB

AL009126.YCKB        Location/Qualifiers
FT   CDS_pept        complement(367995..368858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BSU_03380"
FT                   /old_locus_tag="BSU03380"
FT                   /product="amino acid ABC transporter (binding lipoprotein
FT                   subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23038252; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12132"
FT                   /db_xref="GOA:P42400"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="PDB:2IEE"
FT                   /db_xref="SubtiList:BG11178"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42400"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23038252"
FT                   /protein_id="CAB12132.1"
FT                   /translation="MKSFMHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKG
FT                   KIVVATSGTLYPTSYHDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVN
FT                   SGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAA
FT                   TTVYMEVARKYGAKEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITI
FT                   HPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDAD
FT                   VQDVDL"
     gtgaaatcat tcatgcattc caaagccgtt atattcagtt tcacaatggc tttctttctt        60
     atattggcag cctgttccgg caaaaatgaa gccgattcca aggatacagg ctgggagcag       120
     attaaggata aagggaaaat cgtagtcgct acatcaggta cgctctatcc cacttcttat       180
     cacgatactg actctggctc tgataagctg acgggctacg aggttgaagt tgttcgtgaa       240
     gcggcaaaac gcttggggct gaaggttgag ttcaaggaga tgggcattga cgggatgctg       300
     acagcggtga acagcggaca ggttgacgca gccgcgaatg acatcgatgt gacgaaggac       360
     cgtgaggaga agttcgcatt ttccactcca tataaatatt catacggcac ggcaattgtc       420
     cgaaaagacg atttatcagg gattaaaacg ctcaaggatt taaaagggaa gaaagcggct       480
     ggcgcggcta caaccgtcta catggaggtc gcgagaaaat acggcgccaa agaagtgatt       540
     tatgataatg cgacgaatga gcaatattta aaagatgttg ccaacggacg cactgacgtc       600
     attttaaacg actattacct gcagacactt gcgctcgcgg cattcccgga tctcaacatt       660
     acaattcatc ctgacatcaa gtacatgccg aacaaacagg cccttgtcat gaaaaaaagc       720
     aatgcggcac ttcagaaaaa gatgaacgaa gcattgaaag agatgagcaa ggatggctct       780
     ttgactaaac tgtcgaaaca attcttcaat aaagcagatg tatcaaaaaa aattgatgcc       840
     gacgttcagg acgttgattt gtaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page