(data stored in ACNUC7421 zone)

EMBL: AL009126.YCKC

AL009126.YCKC        Location/Qualifiers
FT   CDS_pept        369236..369691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckC"
FT                   /locus_tag="BSU_03390"
FT                   /old_locus_tag="BSU03390"
FT                   /product="conserved integral membrane protein of unknown
FT                   function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12133"
FT                   /db_xref="GOA:P42401"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="SubtiList:BG11179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42401"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12133.1"
FT                   /translation="MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFI
FT                   SLVVLLYSILLPMFWRGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGL
FT                   GLIASLILIAVREDKRTLHDLIAGTYVTYATPGEEELNADEEIRKSE"
     atgaatattt acaaaccagc cggattttgg atcagacttg gagctgcatt gttagactac        60
     attatagtct ccgtgccgct tttgctgatc tattggctga ttacaggaaa agacccaaac       120
     gacagcatgt tcatcagttt ggttgttctg ctgtattcta ttttgctgcc gatgttttgg       180
     cgcggttatc ttatcggaaa aaggatctgc ggaatcagaa tcgtaaaaaa agacggatca       240
     caggtcagtc tgttaacaat gtttttacgg gttattgtag ccggcctggt ttactgtata       300
     accttcggac tcggcttgat cgccagcctg attctgattg ccgtacgaga agacaaacgg       360
     accctgcatg atttaatcgc gggaacatat gtcacttatg cgacaccagg tgaagaggaa       420
     cttaatgctg acgaagagat tagaaagagc gaataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page