(data stored in ACNUC7421 zone)

EMBL: AL009126.YCKD

AL009126.YCKD        Location/Qualifiers
FT   CDS_pept        369773..370105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckD"
FT                   /locus_tag="BSU_03400"
FT                   /old_locus_tag="BSU03400"
FT                   /product="putative exported protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12134"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="SubtiList:BG11180"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42402"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12134.1"
FT                   /translation="MKRITINIITMFIAAAVISLTGTAEAAEKQQQSPANVTLTDQQKK
FT                   EIEQLEAEILKKRKDVISKYVQYGILPKERGEHIKNHLDKHFEMMKQNGFVPKHHPHPH
FT                   KFEKRH"
     atgaaacgaa taaccatcaa cattatcaca atgttcattg cagcggctgt catttctctg        60
     accggtacag ctgaggccgc tgaaaaacag cagcagtctc ccgcaaatgt tacactgaca       120
     gatcagcaaa agaaagagat tgaacaactg gaagcagaga ttcttaaaaa gcgcaaagac       180
     gtgatctcaa agtatgtaca atacggtatc ctgcctaaag aaagaggaga acacatcaaa       240
     aatcacttgg acaaacactt tgaaatgatg aaacaaaacg gctttgttcc aaagcaccat       300
     cctcatccgc ataaatttga aaaaagacat taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page