(data stored in ACNUC7421 zone)

EMBL: AL009126.YCLD

AL009126.YCLD        Location/Qualifiers
FT   CDS_pept        414819..415283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /locus_tag="BSU_03652"
FT                   /old_locus_tag="BSU03652"
FT                   /product="putative FMN-binding enzyme subunit"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15979273, 18388975;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03652"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12159"
FT                   /db_xref="GOA:C0SPB5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="SubtiList:BG12025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SPB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12159.2"
FT                   /translation="MIRVNCMSDRLFELLDGSCLNEKQHEAFVLQTVSEDGWPHAAMIS
FT                   AGEIIALSRTDIRIALWKNTMTSANILRTGKAQFTAWWKGAAYYVKLECAPLPPLKDAE
FT                   YERDRFSCRIVSVKEDVAKYADLTSGVRIQLHSPEEVLSRWKKTLEDLKR"
     ttgatccgcg tgaactgtat gtcagaccgt ctctttgagc tgcttgacgg gagctgcctg        60
     aatgagaagc agcatgaggc cttcgttctg caaacagtat cagaggatgg ctggccgcat       120
     gccgctatga tcagtgcagg tgaaatcatc gcgctgagcc gaactgatat ccgaatcgct       180
     ctgtggaaaa acacaatgac ttcggccaac atccttcgca caggaaaagc acagttcacg       240
     gcgtggtgga agggagcggc ctattatgta aagcttgaat gcgcgccttt accgcctttg       300
     aaagatgccg aatatgaaag agaccgtttt tcctgccgca tcgtttcagt gaaagaggac       360
     gttgcgaaat acgctgattt gacttcaggt gtccgtatac agcttcacag ccctgaagag       420
     gtgctgagca gatggaaaaa gaccctggaa gatttaaaac ggtaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page