(data stored in SCRATCH zone)

EMBL: AL009126.YCLE

AL009126.YCLE        Location/Qualifiers
FT   CDS_pept        415350..416195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclE"
FT                   /locus_tag="BSU_03660"
FT                   /old_locus_tag="BSU03660"
FT                   /product="putative hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12160"
FT                   /db_xref="GOA:P94407"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12026"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12160.2"
FT                   /translation="MERAGICHSDGFDLAYRIEGEGAPILVIGSAVYYPRLFSSDIKQK
FT                   YQWVFVDHRGFAKPKRELRAEDSRLDAVLADIERMRTFLQLEDVTILGHSGHAFMALEY
FT                   ARTYPKQVRKVALFNTAPDNSEERQRKSESFFMETASLERKKRFEKDIENLPQDIDKDP
FT                   ERRFVHMCIRAEAKSFYQERPHAAALWDGVFTNMPIIDELWGNTFARIDLLQRLADVRM
FT                   PVYIGLGRYDYLVAPVSLWDAVDGLYPHVDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
FT                   "
     atggaacgtg cggggatctg tcactcggac ggctttgatt tagcttatcg aattgagggc        60
     gagggcgcac ccatccttgt gatcgggagt gcggtttact atccgcgcct tttttcctca       120
     gatatcaaac agaaatatca atgggtcttt gtcgaccata ggggatttgc taagcctaag       180
     cgggagcttc gtgcggagga ttcgaggctt gatgctgtct tggctgatat cgaaaggatg       240
     agaacatttc ttcagcttga ggatgttact atcctgggac attccgggca cgcttttatg       300
     gctttagagt atgccaggac atatcccaaa caagttcgga aggtggcgct ctttaatact       360
     gcgcctgata acagtgaaga aagacagcga aaaagcgaat catttttcat ggaaacagcc       420
     agtcttgaga gaaagaaacg ctttgaaaaa gacatcgaga atttgccgca ggacatcgac       480
     aaagatcctg aaaggcgctt tgtgcacatg tgtattcgcg ctgaagcgaa aagcttttat       540
     caagagcggc cgcatgctgc tgccttatgg gacggtgtat tcacgaatat gccgatcatt       600
     gatgaattat ggggcaatac atttgcccgg attgatcttc ttcagcggtt agctgatgtt       660
     cgtatgccgg tgtatatcgg attagggaga tatgattatt tggttgcgcc cgtttcgcta       720
     tgggatgctg ttgacggttt atatccccat gttgataagg ttatttttga aaagagcggc       780
     catcagccga tgctggaaga accggaagcc tttgatcaaa gcttcaggaa atggcttgat       840
     caataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page