(data stored in ACNUC7421 zone)

EMBL: AL009126.YCLG

AL009126.YCLG        Location/Qualifiers
FT   CDS_pept        417993..419747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /locus_tag="BSU_03680"
FT                   /old_locus_tag="BSU03680"
FT                   /product="putative uronase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12176"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="SubtiList:BG12028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94409"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12176.1"
FT                   /translation="MAEFILNAADFGVPRDGKTDSTERINQCLSTAVSKGYHTVWFPKG
FT                   TYLIDATLGGDLNQRFRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENIT
FT                   ISGGQIIGERDEHTYASAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRG
FT                   LKTNQDYRTSEQIIIRRCEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGID
FT                   IEGYGEGDVDYEEPINVSIRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQT
FT                   VIKGNILRRPEDAAAAPRVGITGLGVSQGKETSDAVIAGNLITGFSTGIDVRGKSVLVT
FT                   NNKISNFENTGILVYQSSDVKVDGNQIQNGLSETRRSIGLRAVLSDDIAFLNNCLIQVV
FT                   DGVNVSGGNMIIKDNLLRKFSRGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAG
FT                   AIIKNNTFKEFKNYPIYCSTSAKTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRT
FT                   AGNPIVIYLNGSAGSIISGNTINNLSAGTATAIQTNTSTNSKIIGNRIFKGTINKHSSD
FT                   TIDGNMIV"
     ttggctgaat tcatattaaa tgcagcggat ttcggtgttc ctagagatgg taaaacggat        60
     tcgacagaac ggattaatca gtgcctcagt acagctgttt cgaaaggcta tcatactgtc       120
     tggtttccaa agggaacata tttaatagac gcaacgcttg gcggagatct taatcagagg       180
     tttcgaaacg cggggatcat tgttcccggc aaccttgaga ttatgatgga ccccgaatgt       240
     atcatgaaag tgataccgaa tagttcgtgg ggttattccg cattttatgt aggcaagcaa       300
     gagaatataa ctatttccgg aggacaaatt atcggcgaac gggatgagca tacgtatgcc       360
     tcggcgggga taaggtcaac ccatgaatgg ggctttggca tatgtattga aggatgctcg       420
     aatgttgtca ttgatgatgt gaaaatttcc gattttaccg gcgatgggat catagtcagc       480
     ccaaggggat taaagaccaa tcaagattat cgaacgtcag agcaaattat catccgccgc       540
     tgtgaggttc ggcggtcgag gagaaataac atttccatta ccggatgtga catggtcacg       600
     gtggaggaat gcttgattga agatgccgga acggggaatg gaacagcgcc gaaattcgga       660
     attgacattg aaggatatgg cgaaggtgac gttgattatg aggaaccgat taatgtatca       720
     attcgcaata accactttgt tggaaacgtt tcaagttctg tgaccaattt taacgggtat       780
     ggcattttaa tagaaggaaa tcactcagac aatacaatca gctacggata tgggacgcaa       840
     acagtgatca agggcaatat tctgagacgc cctgaagacg cggcggctgc gccaagagtc       900
     gggataaccg gactcggtgt atcacaagga aaagagacca gtgatgcagt gatcgctggc       960
     aacctcatta ccggattttc aactggaatt gatgtcaggg gaaagagcgt tcttgtgacg      1020
     aacaacaaaa tcagcaactt tgaaaacaca gggatattgg tttatcagtc ctccgacgta      1080
     aaggtagacg gaaaccaaat tcaaaacgga ctgtctgaaa caaggcgcag catcggtctt      1140
     cgcgcagtgc tgtcagatga catcgcattt ctgaataact gtctcattca agtcgttgac      1200
     ggtgtgaacg tttccggcgg aaatatgatc attaaagata atctcctgag aaaattcagc      1260
     cggggcattt ggattgctca agggaacgcg gtgattgaag ggaatacact gaatcctgac      1320
     gcgtttgaag cagtgccgga atcatattct gtttccgtca caaacaatgc cggcgccatc      1380
     atcaaaaaca atacatttaa agagttcaaa aattacccca tttattgctc cacaagtgca      1440
     aaaacctcaa ttatcggcaa ccacttagag cgatccccgc ttttggtcac catctatatc      1500
     agcgcaggtg tgcatgagat ttttgataat accatttcag tcaacagaac agccgggaat      1560
     ccgattgtga tttatctcaa tggctctgca ggctctatca tctctggaaa caccatcaat      1620
     aacctctccg cgggcactgc gacagctatt caaacaaaca cgtcaaccaa ttccaaaatc      1680
     atcggcaacc gcatttttaa agggaccatc aacaaacaca gcagtgatac aatagacggc      1740
     aatatgattg tctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page