(data stored in ACNUC7421 zone)

EMBL: AL009126.YCNE

AL009126.YCNE        Location/Qualifiers
FT   CDS_pept        complement(439282..439569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /locus_tag="BSU_03870"
FT                   /old_locus_tag="BSU03870"
FT                   /product="putative AI-2 degrading enzyme"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17274596, 21454635;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12195"
FT                   /db_xref="GOA:P94425"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="SubtiList:BG12041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12195.1"
FT                   /translation="MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVG
FT                   EENTFVMLEKWKDEAAMKFHNETAHFQGFVAKGKELLSAPLDVVRTELSE"
     atgatcgtat tacaagctta catcaaagta aaaccagaaa aacgcgagga atttttgagc        60
     gaggctcaat cacttgttca gcattcaaga gctgaggaag gcaacgcgca atacgaccta       120
     ttcgaaaaag taggcgaaga aaatacattt gtcatgcttg aaaaatggaa agatgaagcg       180
     gcaatgaaat tccataacga aactgcgcat ttccaagggt ttgtcgcaaa aggaaaagaa       240
     ctgctgagcg ctcctcttga tgttgtccgc acagagctta gcgagtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page