(data stored in SCRATCH zone)

EMBL: AL009126.YCNL

AL009126.YCNL        Location/Qualifiers
FT   CDS_pept        449198..449551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnL"
FT                   /locus_tag="BSU_03970"
FT                   /old_locus_tag="BSU03970"
FT                   /product="putative reductase or disulfide isomerase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   18307109, 27010565; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12205"
FT                   /db_xref="GOA:P94434"
FT                   /db_xref="SubtiList:BG12048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94434"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12205.1"
FT                   /translation="MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPI
FT                   MLVSLAAIVLLIYLLMLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQ
FT                   NGNIIYRGKRKGS"
     atgaaagaaa caccatgccc gaactgcggc aaacctttga caggcgatat ggtcagatca        60
     tcaaatgtgc cttgtcaatt tcgctgcggc cactgccggg aacggcttta tgaatataaa       120
     gtttcagctc cgattatgct ggtatcatta gcggccatcg tgctgcttat ttatcttttg       180
     atgctcctcc gcaatgcggc aggctcagtg ctgccagctg tacagcacgt gccgatggct       240
     gtatttgcgc ttgtgtgcgc gtatcccgtt tttattgtga gtgagcggat gattgcaaag       300
     tacgtgattc aaaatggcaa catcatttat agaggaaaga gaaaaggctc ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page