(data stored in SCRATCH zone)

EMBL: AL009126.YCSA

AL009126.YCSA        Location/Qualifiers
FT   CDS_pept        452830..453894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsA"
FT                   /locus_tag="BSU_04000"
FT                   /old_locus_tag="BSU04000"
FT                   /product="putative tartrate dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.93"
FT                   /EC_number="1.1.1.83"
FT                   /EC_number="4.1.1.73"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10568751, 12356321; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12208"
FT                   /db_xref="GOA:P42958"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="SubtiList:BG11222"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42958"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12208.3"
FT                   /translation="MTMKQFEIAAIPGDGVGKEVVAAAEKVLHTAAEVHGGLSFSFTAF
FT                   PWSCDYYLEHGKMMPEDGIHTLTQFEAVFLGAVGNPKLVPDHISLWGLLLKIRRELELS
FT                   INMRPAKQMAGITSPLLHPNDFDFVVIRENSEGEYSEVGGRIHRGDDEIAIQNAVFTRK
FT                   ATERVMRFAFELAKKRRSHVTSATKSNGIYHAMPFWDEVFQQTAADYSGIETSSQHIDA
FT                   LAAFFVTRPETFDVIVASNLFGDILTDISSSLMGSIGIAPSANINPSGKYPSMFEPVHG
FT                   SAPDIAGQGLANPIGQIWTAKLMLDHFGEEELGAKILDVMEQVTADGIKTRDIGGQSTT
FT                   AEVTDEICSRLRKL"
     atgacgatga aacaatttga gattgcggca ataccgggag acggagtagg aaaagaggtt        60
     gtagcggctg ctgagaaagt gcttcataca gcggctgagg tacacggagg tttgtcattc       120
     tcattcacag cttttccatg gagctgtgat tattacttgg agcacggcaa aatgatgccc       180
     gaagatggaa tacatacgct tactcaattt gaagcagttt ttttgggagc tgtcggaaat       240
     ccgaagctgg ttcccgatca tatatcgtta tgggggctgc tgctgaaaat ccggagggag       300
     cttgagcttt ccattaatat gagacccgcc aaacaaatgg caggcattac gtcgccgctt       360
     ctgcatccaa atgattttga cttcgtggtg attcgcgaga acagtgaagg tgaatacagt       420
     gaagttggcg ggcgcattca cagaggcgat gatgaaatcg ccatccagaa tgccgtgttt       480
     acgagaaaag cgacagaacg tgtcatgcgc tttgccttcg aattggcgaa aaaacggcgc       540
     agccatgtga caagcgccac aaagtctaac ggcatttatc acgcgatgcc gttttgggat       600
     gaagtctttc agcagacagc cgctgattat agcggaatcg aaacatcatc tcagcatatt       660
     gatgcgctgg ccgctttttt tgtgacgcgt ccggaaacgt ttgatgtcat tgtggcgagc       720
     aacttgttcg gtgatatttt aaccgacatc agctcaagcc tgatgggaag catcggcatt       780
     gcgccttctg cgaacatcaa tccatccggc aaatatccgt ccatgtttga accggttcac       840
     ggctcagctc ctgacattgc cggacagggc cttgccaatc cgatcggcca gatttggaca       900
     gcgaagctga tgctcgacca cttcggagag gaagaattgg gggcgaaaat tctggatgta       960
     atggagcaag tgactgccga cggcatcaaa acacgcgaca ttgggggaca aagcacaacg      1020
     gctgaggtca ctgatgaaat ctgttcgcgc ttaagaaagc tctga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page