(data stored in ACNUC7421 zone)

EMBL: AL009126.YCSD

AL009126.YCSD        Location/Qualifiers
FT   CDS_pept        455346..455738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsD"
FT                   /locus_tag="BSU_04030"
FT                   /old_locus_tag="BSU04030"
FT                   /product="putative hydroxyacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12682299, 16291680,
FT                   22720735; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12211"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="SubtiList:BG11225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12211.2"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEALAQTAAFTGITDENSLGLLSSVKKAEKLGEAVPGDRLDLTFEVTRNRRG
FT                   FVFGHAKASVGEQPVAEAEIGIYIEK"
     atgaactcat tatctttgcc tcaccgctat ccatttttgt ttattgatgg cgtgacggat        60
     agcgagcccg gcaaacatgc ggcagcttat aagctgatta gtgagaacga ctggtttatc       120
     actgatacgc aaacagaaat gccgttttca cttgtgattg aagcgcttgc gcaaaccgcg       180
     gcttttacag gaattacaga tgagaacagc ttgggattat tgtcttcggt gaagaaagcg       240
     gaaaagctgg gagaagctgt gcctggtgac cggcttgatc ttacgtttga agtcacgcgc       300
     aatcggcgcg ggtttgtgtt cggacatgcc aaggcatcag ttggagagca gcctgttgct       360
     gaagctgaaa tcggcatcta tattgaaaaa tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page