(data stored in ACNUC7421 zone)

EMBL: AL009126.YCXB

AL009126.YCXB        Location/Qualifiers
FT   CDS_pept        complement(404458..405015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxB"
FT                   /locus_tag="BSU_03540"
FT                   /old_locus_tag="BSU03540"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function; PubMedId : 21965396"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12148"
FT                   /db_xref="GOA:Q08793"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="SubtiList:BG10173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08793"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12148.1"
FT                   /translation="MIQYASESINLPGEITFKDVREIFFYQIAKISCFYFLLFCAIFAA
FT                   VNFINGWPRIVYGSDALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERMKSKR
FT                   TYTLNQEGIRICSKKYDLIFNWDEITAVFEYKNIFRVNTSSGQYIAIPKHFFHSEEEMN
FT                   RFKEIILKNTETKKLKFKKDQH"
     atgattcaat atgctagtga aagtatcaat cttccaggag aaatcacttt taaggatgta        60
     agagaaatct ttttttatca aatcgcaaaa atatcatgct tttactttct attgttttgc       120
     gccatatttg ctgcagttaa cttcattaac ggatggcccc gtatcgttta tggaagtgac       180
     gcgcttaact tgtttatgaa cagtatgttg attatcgtga tgtccgttct gtttacactg       240
     ctgctcctcc ttcttctata tgtgaagttt tccagagcat acaagaagaa cgaacggatg       300
     aaatccaaaa gaacatatac tctgaaccaa gaaggaattc gtatatgttc taaaaaatat       360
     gacctcattt tcaattggga tgaaattaca gctgttttcg aatataaaaa tatcttcagg       420
     gtcaatacat caagtggcca atatattgcg atccccaaac atttttttca ctccgaagag       480
     gagatgaaca gattcaagga gattatcctt aaaaataccg aaacaaaaaa actcaaattt       540
     aaaaaggatc agcattga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page