(data stored in SCRATCH zone)

EMBL: AL009126.YCZC

AL009126.YCZC        Location/Qualifiers
FT   CDS_pept        complement(292881..293264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczC"
FT                   /locus_tag="BSU_02710"
FT                   /old_locus_tag="BSU02710"
FT                   /product="putative integral membrane protein of unknown
FT                   function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12065"
FT                   /db_xref="GOA:O31469"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="SubtiList:BG12778"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31469"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12065.1"
FT                   /translation="MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILM
FT                   LIVYPLLMPLTNWKGTLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLT
FT                   AAFTKKKQTVHDMAAKTIVLKAE"
     ttggaactag ctggtttcat gctgcgcgcc tgcgctcttt tacttgatgt aatcattgcc        60
     gcagcagtga ttttggcagc cggatttacg tttggcgatg ggtccgccgg tgtcattatt       120
     gtcgccatat tgatgctgat tgtgtaccct ttgctgatgc cgctgacaaa ttggaagggc       180
     acactgggca aaaaaatcat cgggctgcaa atcgtgaggg acgaaacata taaaaaaata       240
     tccttcccgc aagccattgt ccgttacctg atagcgtggg tgcatgtgtt ctcccgcctg       300
     atctatttga ctgccgcatt tacgaagaaa aaacaaaccg ttcatgatat ggctgcgaaa       360
     accattgtgc tgaaagcaga ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page