(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZE

AL009126.YCZE        Location/Qualifiers
FT   CDS_pept        complement(408240..408887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczE"
FT                   /locus_tag="BSU_03580"
FT                   /old_locus_tag="BSU03580"
FT                   /product="integral inner membrane protein regulating
FT                   antibiotic production"
FT                   /function="15.11: Biosynthesis of natural products"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15849754, 16850406, 17827323,
FT                   14762003, 16707694, 17827323, 25288929; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12152"
FT                   /db_xref="GOA:O34927"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="SubtiList:BG12779"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34927"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12152.2"
FT                   /translation="MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLF
FT                   QHFGLTVGQWSIIIGALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYT
FT                   GSIIVFSLGVVLIGYGVGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFA
FT                   AWGMGGPIGFGTILTAILTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH"
     gtgaagcaag aacttgttct gcgctggaca ttttattttg ccggtttgat cattttggct        60
     tttggtgtat ccctgacgat agaaggaaaa gcactcggca ttagtccgtg ggatgcattt       120
     cattacagcc tgtttcagca cttcgggctt accgtcggcc agtggtccat cattattgga       180
     gcgctcatcg tcggattcac gtcattgttt acgagagctt ggccgaaaat tggtgccctc       240
     ctgaatatgg tgctcattgg tgtatttata gattttttca atttcattct gcctgccctc       300
     tcgacctaca caggctcgat catcgtcttc tctctaggcg tggtgctgat tggttacggc       360
     gtcggtgttt atgtatcagc aggccttggc gcggggccgc gtgattcact gatgatgctg       420
     attacagaaa aaaccggctg gaatgtgcaa tgggtgcgga acggcatgga attaaccatt       480
     ttgtttgcgg catggggcat gggcggaccg atcggttttg gcaccatttt gaccgccatc       540
     ctcaccggac ttattttgcg tttttcattg ccccagtcaa tccagttgct gaattatgct       600
     gtggcaaggc ggacagccgc agtgaaagca tctccgcctg tacactaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page