(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZH

AL009126.YCZH        Location/Qualifiers
FT   CDS_pept        complement(454652..455260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczH"
FT                   /locus_tag="BSU_04020"
FT                   /old_locus_tag="BSU04020"
FT                   /product="putative hydrolase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12210"
FT                   /db_xref="GOA:O31482"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12782"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31482"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12210.2"
FT                   /translation="MFPKPLVILAHEIYGVNSHMKKMGRLIKMAGYDVLTPNLLGEDEV
FT                   YTLKEEKTAYEQFTKHERLKTGETIIQNVIRQNAGRHIFVIGFSVGATIAWKCSSMPEV
FT                   SGSVCYYGSRIRDSLHHMPACPVLLFFPNYEPSFDVALLIKKLREKQHTHLEIYQFDAL
FT                   HGFANPDSVYFNRALFFKTLSIIKNGAESRLRTVSSSFF"
     atgttcccaa aaccgcttgt cattctcgca cacgaaatat atggtgtaaa cagccatatg        60
     aaaaagatgg gccggctgat caaaatggct ggatatgatg tgttgacgcc caacctgctc       120
     ggcgaggatg aagtctacac actgaaagaa gaaaaaacgg catacgaaca atttacaaaa       180
     cacgaaaggc tgaaaacggg agaaaccatc atccagaatg tgatcaggca aaacgccgga       240
     cggcacatct ttgtgattgg attcagcgtg ggggctacta tcgcatggaa atgcagcagt       300
     atgcctgagg tgagcggatc ggtttgttat tacggttccc ggatacgcga ctctcttcat       360
     cacatgccag cctgcccggt cctattgttt ttccctaatt atgagccgtc gtttgacgta       420
     gcgcttctta tcaaaaaact gcgggaaaaa cagcataccc atcttgagat ttaccaattc       480
     gatgcgcttc acggcttcgc caatcctgat tctgtttatt tcaacagggc ccttttcttc       540
     aaaacgcttt ctatcataaa aaacggggcg gaaagccggc tccgcaccgt ttcatcatca       600
     tttttttaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page