(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZI

AL009126.YCZI        Location/Qualifiers
FT   CDS_pept        463245..463490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczI"
FT                   /locus_tag="BSU_04120"
FT                   /old_locus_tag="BSU04120"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12219"
FT                   /db_xref="GOA:P42970"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="SubtiList:BG12783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42970"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12219.1"
FT                   /translation="MFRIFKMSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQ
FT                   GLEERKKENDGSGAFNIYTAVFVWSVSLIGFTLHII"
     ttgtttcgga tttttaaaat gtcttttgcg gttatcatta ttatactggc gcttattgct        60
     tttaactata cggaacacac ctctgtaatc caatcggtca tgctcgtctt tcttggtgcg       120
     gtcatgttta tgcaggggct tgaagagcgc aaaaaagaaa atgacggctc aggcgctttt       180
     aatatttata ccgccgtttt tgtatggtct gtctccctta tcggttttac acttcatatt       240
     atataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page