(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZJ

AL009126.YCZJ        Location/Qualifiers
FT   CDS_pept        complement(463496..463783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczJ"
FT                   /locus_tag="BSU_04130"
FT                   /old_locus_tag="BSU04130"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12220"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="SubtiList:BG12784"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31484"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12220.1"
FT                   /translation="MVREAAMLHIKEGLEQEFEDAFRQAAPIISGMKGYITHSLSKCME
FT                   ETHKYLLLVEWETLEDHTEGFRGSSEYQEWKALLHRFYTPFPTVEHFQDV"
     atggtcagag aggcagcaat gcttcacatt aaagaaggcc ttgaacaaga gtttgaggat        60
     gcattccggc aagctgcgcc gattatttcc ggcatgaagg gctatatcac tcactcgtta       120
     tcaaaatgca tggaggaaac gcataaatat ctgcttcttg tggagtggga aacacttgag       180
     gaccatacgg aaggctttcg cggttcttca gagtatcaag agtggaaagc cttgcttcat       240
     cggttctata ccccgttccc gacggtcgag cattttcagg atgtgtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page